TkA05G010000 | RubberDandelionOmics

Gene overview

TkA05G010000

Reference: TK1151 Chr: Chr05 Coordinates: 2903388-2904836 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1029 bp · TkA05G010000|TK1151|cDNA

TTTTAACCTAATCTTGAAAAAAGACTCGTGGGTTACAATGAAGAAATTGTCGACATGAAATTCTTAGGCCTCCAAGAAGACTTCCTTGCTGTTGCCACTAGTGTCGAACAGGTACGAGTGTATGATCTTTCTTCAATGTCATGCTCTTATGTACTATCCGGCCATACAGACATTGTCCTGTGTCTTGACACATGTACCACATCATCCGGAACAACACTCATTGTAACTGGCAGCAAAGATAATACCGTAAGATTATGGGA...

CDS

Download CDS FASTA

831 bp · TkA05G010000|TK1151|CDS

ATGAAATTCTTAGGCCTCCAAGAAGACTTCCTTGCTGTTGCCACTAGTGTCGAACAGGTACGAGTGTATGATCTTTCTTCAATGTCATGCTCTTATGTACTATCCGGCCATACAGACATTGTCCTGTGTCTTGACACATGTACCACATCATCCGGAACAACACTCATTGTAACTGGCAGCAAAGATAATACCGTAAGATTATGGGATTCCAACACCCATTCTTGCATTGGTATCGGAAGAGGTCACATGGGTGGAATCGG...

Protein

Download Protein FASTA

276 aa · TkA05G010000|TK1151|PROTEIN

MKFLGLQEDFLAVATSVEQVRVYDLSSMSCSYVLSGHTDIVLCLDTCTTSSGTTLIVTGSKDNTVRLWDSNTHSCIGIGRGHMGGIGAVSFSKKSQSFFVTGSSDLTLKVWSLDDMSDKTLKTKAVTAAHDKDINAVAIAPNDSLVCSGSQDRSARIWNLPDLTPGVILKGHKRGIWSVEFSPVDQCVITGSGDKTIKMWAISDGSCLKTFEGHTSSVFKVQFVTRGAQVVSCGADGLVKMWTVKSNECVATYDQHEDKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G010000`
TK1151 ID	TkA05G010000
OH-1004 ID	LXL04_019027
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.200
Protein coverage (%)	TK1151 62.319 / OH-1004 19.261 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G010000

Location Chr05:2903388-2904836 (-)

Description Similar to Tbl3: Transducin beta-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16750`	Essential protein involved in the regulation of cell division planes during embryogenesis which defines cell patterning, especially longitudinal division planes of the proembryo, probably via the regulation of embryo patterning genes expression patterns.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019027 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000480 endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009880 embryonic pattern specification Biological Process

GO:0030490 maturation of SSU-rRNA Biological Process

GO:0042274 ribosomal small subunit biogenesis Biological Process

GO:0051301 cell division Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0030686 90S preribosome Cellular Component

GO:0032040 small-subunit processome Cellular Component

KEGG gene cross-reference

ath:AT5G16750

bta:618429

hsa:10607

mmu:213773

rno:287120

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.516

Rank 1 · TkA05G010000 · TK1151

Nucleus0.353

Rank 2 · TkA05G010000 · TK1151

Lysosome / Vacuole0.101

Rank 3 · TkA05G010000 · TK1151

Cell membrane0.086

Rank 4 · TkA05G010000 · TK1151

Golgi apparatus0.082

Rank 5 · TkA05G010000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23385Beta-prop_IFT140_2nd4-27 aa

PF24817WD40_WDHD1_1st6-118 aa

PF29037DSE1_N6-39 aa

PF23775Beta-prop_RIG_2nd7-73 aa

PF23761Beta-prop_DCAF47-69 aa

PF23383Beta-prop_IFT140_1st7-35 aa

PF23770Beta-prop_RIG_1st7-44 aa

PF23756Beta-prop_HPS57-26 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G010000	`PF23385`	Beta-prop_IFT140_2nd	4	27	0.004	17.1
TkA05G010000	`PF24817`	WD40_WDHD1_1st	6	118	2.6e-32	112.9
TkA05G010000	`PF29037`	DSE1_N	6	39	5.9e-10	39.5
TkA05G010000	`PF23775`	Beta-prop_RIG_2nd	7	73	2e-10	41.3
TkA05G010000	`PF23761`	Beta-prop_DCAF4	7	69	1.4e-09	38.1
TkA05G010000	`PF23383`	Beta-prop_IFT140_1st	7	35	4.3e-06	26.4
TkA05G010000	`PF23770`	Beta-prop_RIG_1st	7	44	0.0011	18.4
TkA05G010000	`PF23756`	Beta-prop_HPS5	7	26	0.026	14.5
TkA05G010000	`PF25173`	Beta-prop_WDR3_1st	8	115	4.9e-50	170.5
TkA05G010000	`PF25174`	Beta-prop_THOC3	8	113	7.8e-42	143.9
TkA05G010000	`PF25172`	Beta-prop_WDR3_2nd	8	159	2.3e-38	132.8
TkA05G010000	`PF24807`	WD40_CDC20-Fz	8	117	8e-34	118.0
TkA05G010000	`PF23414`	Beta-prop_EML_2	8	50	4.1e-22	79.5
TkA05G010000	`PF25171`	Beta-prop_WDR36-Utp21_1st	8	68	9.6e-16	58.7
TkA05G010000	`PF25168`	Beta-prop_WDR36-Utp21_2nd	8	76	1.6e-15	57.9
TkA05G010000	`PF12894`	ANAPC4_WD40	8	76	5.3e-07	30.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFE2`	Arabidopsis thaliana	sp\|Q9LFE2\|TOZ_ARATH Protein TORMOZ EMBRYO DEFECTIVE	66.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card