TkA05G009980 | RubberDandelionOmics

Gene overview

TkA05G009980

Reference: TK1151 Chr: Chr05 Coordinates: 2900831-2902514 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1552 bp · TkA05G009980|TK1151|cDNA

TAGAAAAAGCAGATCAAGGCATATTTGTTTGGTAACAACACTGAAAAACGTTTACTACCAATTATACTCGGCATTGGTTTAAGATAGCCTTCCCAAACACATACGTTAAGTGTGTTGACAGTGTTGTGATCGAAATGGCGAAGAAGGAGAAAATCAACACAAAATTTCCCAAAAACGGATGAAGTCTGAAGAAATCGTGGCGGAGGGAGGTGAAGATCGAATCAGTGCGTTGCAGGATTGCTTGCTTCTCGAAATTCTCT...

CDS

Download CDS FASTA

891 bp · TkA05G009980|TK1151|CDS

ATGAAGTCTGAAGAAATCGTGGCGGAGGGAGGTGAAGATCGAATCAGTGCGTTGCAGGATTGCTTGCTTCTCGAAATTCTCTCTCGTTTACCCTCCACAAAATACGCCATTAGAACAGGTACACTCTCCAAGCGATGGAAACATGTTTGGACTTCGGTTCCCATCCTCAGTTTCACAAGTAGAGACTATGATCCCTTTCTTGAATGGCCCCCAAAGACTAACATAATGCCCGATTTCTTTTCGTTGGTTGACAAAACCCT...

Protein

Download Protein FASTA

296 aa · TkA05G009980|TK1151|PROTEIN

MKSEEIVAEGGEDRISALQDCLLLEILSRLPSTKYAIRTGTLSKRWKHVWTSVPILSFTSRDYDPFLEWPPKTNIMPDFFSLVDKTLTQCRQLNLQKFEVFSGYDIRFESQVHNWIRFAISRDVEELTLMFFNIDSVAEVLLDQLIFTGSCFRDLTLQGCKLNPSGPISWKNLRSLCIYDADVSEDVIENILSGSPLLETFELNCYGYRRIDITSKSVKKLVFSGYLDFNTFCGGNCIEINAPNILSLTIQNDLTLGKLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G009980`
TK1151 ID	TkA05G009980
OH-1004 ID	LXL04_027366
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	61.700
Protein coverage (%)	TK1151 90.541 / OH-1004 11.401 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G009980

Location Chr05:2900831-2902514 (+)

Description Similar to At1g49610: Putative F-box protein At1g49610

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49610`	Putative F-box protein At1g49610.	No verified direct reference in this release
`At5g02930`	Putative F-box/LRR-repeat protein At5g02930.	No verified direct reference in this release
`At5g02920`	F-box/LRR-repeat protein 25.	No verified direct reference in this release
`At3g03360`	F-box/LRR-repeat protein At3g03360.	No verified direct reference in this release
`At3g18150`	Putative F-box/LRR-repeat protein At3g18150.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_027366 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT1G49610

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.829

Rank 1 · TkA05G009980 · TK1151

Cytoplasm0.225

Rank 2 · TkA05G009980 · TK1151

Endoplasmic reticulum0.040

Rank 3 · TkA05G009980 · TK1151

Cell membrane0.037

Rank 4 · TkA05G009980 · TK1151

Plastid0.020

Rank 5 · TkA05G009980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box15-56 aa

PF30152IN080_446-60 aa

PF23622LRR_At1g61320_AtMIF191-267 aa

PF30152IN080_4101-108 aa

PF24758LRR_At5g56370113-255 aa

PF00646F-box185-193 aa

PF30152IN080_4202-216 aa

PF30152IN080_4223-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G009980	`PF00646`	F-box	15	56	0.00015	22.2
TkA05G009980	`PF30152`	IN080_4	46	60	0.24	11.8
TkA05G009980	`PF23622`	LRR_At1g61320_AtMIF1	91	267	1.4e-14	55.0
TkA05G009980	`PF30152`	IN080_4	101	108	0.24	11.8
TkA05G009980	`PF24758`	LRR_At5g56370	113	255	2.4e-13	51.0
TkA05G009980	`PF00646`	F-box	185	193	0.00015	22.2
TkA05G009980	`PF30152`	IN080_4	202	216	0.24	11.8
TkA05G009980	`PF30152`	IN080_4	223	226	0.24	11.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FX89`	Arabidopsis thaliana	sp\|Q9FX89\|FB50_ARATH Putative F-box protein At1g49610	34.000%	Swiss-Prot	Medium
`Q9LYZ2`	Arabidopsis thaliana	sp\|Q9LYZ2\|FBL80_ARATH Putative F-box/LRR-repeat protein At5g02930	29.900%	Swiss-Prot	Low
`Q1PE04`	Arabidopsis thaliana	sp\|Q1PE04\|FBL25_ARATH F-box/LRR-repeat protein 25	33.700%	Swiss-Prot	Medium
`Q84W80`	Arabidopsis thaliana	sp\|Q84W80\|FBL42_ARATH F-box/LRR-repeat protein At3g03360	32.000%	Swiss-Prot	Medium
`Q9LV26`	Arabidopsis thaliana	sp\|Q9LV26\|FBL45_ARATH Putative F-box/LRR-repeat protein At3g18150	32.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card