Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1350 bp · TkA05G009910|TK1151|cDNA
CAAATAGTTAACAGCCTAAGTTGGAAAATACAAAACGTCAGGGGCTTTTTGTGAAAAGTAGCAAAGTTGGGGCAGGTGTCGTTGGGATGCCTTTACCACCAAAATTGATGTGGCCATCCGAGGTTTTGGCATAAACCCTAAAACCCCTTTTGAAGATACTTCTACGTGAACGTGGAAGCCCCGTCTCCGATCAAATGAGAGCTTGTGCATTCGTTTCGGAGATATGGAGGAAAAATCAAGCAAATTTGAGTATATTAAGG...
972 bp · TkA05G009910|TK1151|CDS
ATGAGAGCTTGTGCATTCGTTTCGGAGATATGGAGGAAAAATCAAGCAAATTTGAGTATATTAAGGTGCTATGGATATTCTCGACAGCTCCATTCCAGCTATCGTTTCGTTCAATCGCCATTTAAGGAGATAACAATCCAACCGCCTGTGTTCCACAATTCCCTTATTGCTTCTTCTATTCAACAGTGTAGATTTTTTTCATTTGCATCTTCTCGAACTGATGAAGATGAGACTGTTAAACCTGGGAATAACCCAGGAGG...
Protein
Download Protein FASTA323 aa · TkA05G009910|TK1151|PROTEIN
MRACAFVSEIWRKNQANLSILRCYGYSRQLHSSYRFVQSPFKEITIQPPVFHNSLIASSIQQCRFFSFASSRTDEDETVKPGNNPGGTMETNSDLETELPDKKVDSGTRDGSQSVKRRRRGTKRTKFSDSDSDSESNLSRDDLVNLLAKKKELLNKKHKEVEIMQEKFLMSYAENNNIIERTKREAENSKKFAIQTFAKSLLDVADNLGRASDVVKDKFTKMDTSEDTTGALPLLKTLMEGVDMTEKQLAEVLKKFGVEK...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G009910 |
|---|---|
| TK1151 ID | TkA05G009910 |
| OH-1004 ID | LXL04_030900 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 74.400 |
| Protein coverage (%) | TK1151 53.251 / OH-1004 21.366Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G009910 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr05:2878834-2880821 (-) | |||||||||
| Description | Similar to FBL14: F-box/LRR-repeat protein 14 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0006457 protein folding Biological Process GO:0006511 ubiquitin-dependent protein catabolic process Biological Process GO:0009408 response to heat Biological Process GO:0009411 response to UV Biological Process GO:0010286 heat acclimation Biological Process GO:0030150 protein import into mitochondrial matrix Biological Process GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process GO:0001405 PAM complex, Tim23 associated import motor Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0009507 chloroplast Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G80570 ath:AT4G26780 ath:AT5G55200 nwi:Nwi_0195 oca:OCAR_4415 ocg:OCA5_c01160 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF17015DUF5094116-192 aaPF01025GrpE147-312 aaPF18606HTH_53235-266 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA05G009910 | PF17015 | DUF5094 | 116 | 192 | 0.09 | 13.6 |
| TkA05G009910 | PF01025 | GrpE | 147 | 312 | 8.6e-46 | 156.3 |
| TkA05G009910 | PF18606 | HTH_53 | 235 | 266 | 0.039 | 14.3 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.