TkA05G006080 | RubberDandelionOmics

Gene overview

TkA05G006080

Reference: TK1151 Chr: Chr05 Coordinates: 1836030-1839236 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1728 bp · TkA05G006080|TK1151|cDNA

AAATTATAGAAACACGTATGCTGTGAAATCCACCTATGGTGTAATTTTTTATGTTAAGAAATATATATCTTAGTATACTGATAGCACATATTTAAAATATTTGTAGGAGAGGGGTAAAATAATGAACAAATTTGCGGATTTAATCGATGAAAGCCTTGAAGACCTAGCAACATTAGAAACACTTGACGCAGGCAAAGTTTTTAGTTTTGAAATCGACATCGATATTCCCAGTGTATCGAAAGAACTTCGTTACTTTGCTG...

CDS

Download CDS FASTA

1272 bp · TkA05G006080|TK1151|CDS

ATGCCTGGATGTGAGAGGGGTAAAATAATGAACAAATTTGCGGATTTAATCGATGAAAGCCTTGAAGACCTAGCAACATTAGAAACACTTGACGCAGGCAAAGTTTTTAGTTTTGAAATCGACATCGATATTCCCAGTGTATCGAAAGAACTTCGTTACTTTGCTGGTGCAGCTGATAAAATTCATGGAAGAACTTTGAAATTGTCGAGCCAATTTCAAGGCTACACTTTGCTTGAACCAATTGGGGTTGTTGGTCTTAT...

Protein

Download Protein FASTA

423 aa · TkA05G006080|TK1151|PROTEIN

MPGCERGKIMNKFADLIDESLEDLATLETLDAGKVFSFEIDIDIPSVSKELRYFAGAADKIHGRTLKLSSQFQGYTLLEPIGVVGLIIPWNFPSAMFILKCAPALAAGCTMVVKPAEQAPLPALYLAHLAKLAGIPNGVINVVTGFGHTAGSAVASHMDINSVSFTGSTEVGRLIMHAAAASNLKTVSLELGGKSPLLIFDDANVDQAADLALFGSLANKGEICVCSSRVFVQEGIYDELVKKLLEKAKTWVVGDPFDPL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G006080`
TK1151 ID	TkA05G006080
OH-1004 ID	LXL04_009564
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.100
Protein coverage (%)	TK1151 100.000 / OH-1004 78.625 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G006080

Location Chr05:1836030-1839236 (-)

Description Similar to ALDH2B4: Aldehyde dehydrogenase family 2 member B4, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g24503`	Involved in ferulic acid and sinapic acid biosynthesis by oxidation of conyferylaldehyde and sinapaldehyde, respectively.	The Arabidopsis thaliana REDUCED EPIDERMAL FLUORESCENCE1 gene encodes an aldehyde dehydrogenase involved in ferulic acid and sinapic acid biosynthesis.2004 · DOI: 10.1105/tpc.017509

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009564 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006067 ethanol metabolic process Biological Process

GO:0006068 ethanol catabolic process Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0018937 nitroglycerin metabolic process Biological Process

GO:0019752 carboxylic acid metabolic process Biological Process

GO:0046185 aldehyde catabolic process Biological Process

GO:0110095 cellular detoxification of aldehyde Biological Process

GO:1903179 regulation of dopamine biosynthetic process Biological Process

GO:1905627 regulation of serotonin biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G23800

ath:AT3G48000

bta:508629

ssc:733685

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.587

Rank 1 · TkA05G006080 · TK1151

Peroxisome0.213

Rank 2 · TkA05G006080 · TK1151

Nucleus0.168

Rank 3 · TkA05G006080 · TK1151

Mitochondrion0.107

Rank 4 · TkA05G006080 · TK1151

Plastid0.079

Rank 5 · TkA05G006080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00171Aldedh2-413 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G006080	`PF00171`	Aldedh	2	413	2.1e-155	518.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56YU0`	Arabidopsis thaliana	sp\|Q56YU0\|AL2C4_ARATH Aldehyde dehydrogenase family 2 member C4	67.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card