TkA05G004680 | RubberDandelionOmics

Gene overview

TkA05G004680

Reference: TK1151 Chr: Chr05 Coordinates: 1376609-1382048 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4214 bp · TkA05G004680|TK1151|cDNA

TTAACAACTGTCACGCGTATCAAAACTTGCAGTCGGCGGGATATTCAGCGAAACATTTTACTTTCTCCCGCTTGCTGTTTCAAAATCGAAAACAAAAATTGAAGACAAATGTGTGAATTCCCCTTTCTACCCCTGGCCGTCATTCATTCCAATCACTATCCCTACTCCTTCCCGAGAAGCTTTGCATTTGAATTTGTTCATCTATCCTGTTACTGCTCTGCGATTTATTTATCTCATGCTTTCATTACTCTCTCATCGAG...

CDS

Download CDS FASTA

939 bp · TkA05G004680|TK1151|CDS

ATGTGGTTCATATTGACTGGACATAAACTGCAAAGACGTGAATTCCAGCAGATAATTCGGCGGTTAAAAGGAAAAATATGCAGAGTCTCTCATCAATGGTCATATCAAGCAACTCATTTCATCGTCCCTGATCCCATTAAAAGAACAGAGAAGTTCTTTGCTGCTGCTGCTTCCGGAAGTTGGATTCTCAAGACAGATTACTTATCTGCAAGTAATGAGGCAGGAAGATTCCTAACAGAGGAACCTTACGAATGGCACAA...

Protein

Download Protein FASTA

312 aa · TkA05G004680|TK1151|PROTEIN

MWFILTGHKLQRREFQQIIRRLKGKICRVSHQWSYQATHFIVPDPIKRTEKFFAAAASGSWILKTDYLSASNEAGRFLTEEPYEWHKNGLSEDGQINMEAPRKWRLIKKKTGHGAFFGMRVVIYGECIAPTLDTLKRAVKAGDGTILATSPPYTRFLNTNIDYAIVSPGMPRVDIWVQEFIKHEIPCVTADYLVEYVCKPGYPLERHVQFDTNVWAERSYNNLKNRLNEEESSETPRIDDLACEVCGSRDRGEEMLICGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA05G004680`
TK1151 ID	TkA05G004680
OH-1004 ID	LXL04_018935
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 21.458 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA05G004680

Location Chr05:1376609-1382048 (+)

Description Similar to At4g02110: BRCT domain-containing protein At4g02110

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02110`	BRCT domain-containing protein At4g02110.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018935 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000076 DNA replication checkpoint signaling Biological Process

GO:0000724 double-strand break repair via homologous recombination Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:0006277 DNA amplification Biological Process

GO:0006974 DNA damage response Biological Process

GO:0007095 mitotic G2 DNA damage checkpoint signaling Biological Process

GO:0016925 protein sumoylation Biological Process

GO:0030174 regulation of DNA-templated DNA replication initiation Biological Process

GO:0031334 positive regulation of protein-containing complex assembly Biological Process

GO:0032204 regulation of telomere maintenance Biological Process

GO:0033138 positive regulation of peptidyl-serine phosphorylation Biological Process

GO:0033314 mitotic DNA replication checkpoint signaling Biological Process

KEGG gene cross-reference

ath:AT4G02110

hsa:84250

xla:398573

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.953

Rank 1 · TkA05G004680 · TK1151

Cytoplasm0.103

Rank 2 · TkA05G004680 · TK1151

Cell membrane0.025

Rank 3 · TkA05G004680 · TK1151

Endoplasmic reticulum0.011

Rank 4 · TkA05G004680 · TK1151

Mitochondrion0.008

Rank 5 · TkA05G004680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16589BRCT_22-84 aa

PF16770RTT107_BRCT_54-83 aa

PF00533BRCT7-70 aa

PF16589BRCT_2116-193 aa

PF00533BRCT118-195 aa

PF00628PHD126-133 aa

PF00628PHD243-293 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA05G004680	`PF16589`	BRCT_2	2	84	6.2e-08	33.6
TkA05G004680	`PF16770`	RTT107_BRCT_5	4	83	3.4e-05	24.4
TkA05G004680	`PF00533`	BRCT	7	70	4.6e-12	46.7
TkA05G004680	`PF16589`	BRCT_2	116	193	6.2e-08	33.6
TkA05G004680	`PF00533`	BRCT	118	195	4.6e-12	46.7
TkA05G004680	`PF00628`	PHD	126	133	2.6e-06	28.0
TkA05G004680	`PF00628`	PHD	243	293	2.6e-06	28.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O04251`	Arabidopsis thaliana	sp\|O04251\|Y4211_ARATH BRCT domain-containing protein At4g02110	71.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card