Gene Card
Gene overview
cDNA / CDS / Protein Sequences
321 bp · TkA05G002330|TK1151|cDNA
ATGATCAAGTATCAAAAAACAGAGAGAACCGATGGGTCTTCGGAGGTAACGAGAAAACTCATCGGCGTCGTTCAACTAGTACTGGATCCGAATACTAAAATCAATTCGAGAAATTCGTATTCAGTTGGAGAAACAGGGGTTGCTACTAGACCTAAATCAAATAAAAAGAACGAAGATGGAGATGGCGGTGATGATTCTGAACAATCTAAACTTAGATTAGGGCTAAATTCTGCAATTATAAGAGACGGTAGTCGCAAGAT...
321 bp · TkA05G002330|TK1151|CDS
ATGATCAAGTATCAAAAAACAGAGAGAACCGATGGGTCTTCGGAGGTAACGAGAAAACTCATCGGCGTCGTTCAACTAGTACTGGATCCGAATACTAAAATCAATTCGAGAAATTCGTATTCAGTTGGAGAAACAGGGGTTGCTACTAGACCTAAATCAAATAAAAAGAACGAAGATGGAGATGGCGGTGATGATTCTGAACAATCTAAACTTAGATTAGGGCTAAATTCTGCAATTATAAGAGACGGTAGTCGCAAGAT...
Protein
Download Protein FASTA106 aa · TkA05G002330|TK1151|PROTEIN
MIKYQKTERTDGSSEVTRKLIGVVQLVLDPNTKINSRNSYSVGETGVATRPKSNKKNEDGDGGDDSEQSKLRLGLNSAIIRDGSRKIRSNTVDQDVIANPTLRNVY
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA05G002330 |
|---|---|
| TK1151 ID | TkA05G002330 |
| OH-1004 ID | LXL04_035595 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 84.100 |
| Protein coverage (%) | TK1151 41.509 / OH-1004 10.945Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA05G002330 |
|---|---|
| Location | Chr05:712425-712745 (+) |
| Description | Similar to SKD1: Protein SUPPRESSOR OF K(+) TRANSPORT GROWTH DEFECT 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006623 protein targeting to vacuole Biological Process GO:0006914 autophagy Biological Process GO:0006997 nucleus organization Biological Process GO:0007032 endosome organization Biological Process GO:0007033 vacuole organization Biological Process GO:0007080 mitotic metaphase chromosome alignment Biological Process GO:0009306 protein secretion Biological Process GO:0010091 trichome branching Biological Process GO:0010824 regulation of centrosome duplication Biological Process GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process GO:0015031 protein transport Biological Process GO:0016125 sterol metabolic process Biological Process |
| KEGG gene cross-reference | ath:AT2G27600 bta:539357 cal:CAALFM_C503090WA hsa:9525 sce:YPR173C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
No result was found for this query.
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.