TkA04G514650 | RubberDandelionOmics

Gene overview

TkA04G514650

Reference: TK1151 Chr: Chr04 Coordinates: 130049211-130051938 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1429 bp · TkA04G514650|TK1151|cDNA

CAAAAAGCCCCTTAGATTTATTTATCAAACCTAGACCGTAAAACAAAACGTGGGCAGGTTCAAGATTCTCGTATTGCTCAATTGAAACTTGGGCAGCGGCTCGGCTCCTCCTCGCCATTTCTACTAGGTAGAAAGGACACGATTCCGACAGACACGATCGTTGCATAATAATGGCTAAAAAGAAGAGAGATGAAGTGGACGCCGAACCCCAAGTACTCAACCATGGCAATGACGGGTCTCATGACACAAAAAAGAAGAAA...

CDS

Download CDS FASTA

1062 bp · TkA04G514650|TK1151|CDS

ATGGCTAAAAAGAAGAGAGATGAAGTGGACGCCGAACCCCAAGTACTCAACCATGGCAATGACGGGTCTCATGACACAAAAAAGAAGAAAAAGAACAAGACAATAGAGAAAGAGCAGAAGAAAGCGTTAGTAGACGATGTCGATATTACTACTCCTACTGTCAGCATCGCCCTTCCTGGCTCTATCATCGATAACACTCAGTCATTCGAGCTCGCTACTCGGCTTGCTGGCCAAATTTCACGTGCCGCCACTATTTTCAG...

Protein

Download Protein FASTA

353 aa · TkA04G514650|TK1151|PROTEIN

MAKKKRDEVDAEPQVLNHGNDGSHDTKKKKKNKTIEKEQKKALVDDVDITTPTVSIALPGSIIDNTQSFELATRLAGQISRAATIFRIDEVVVFDNQSEPSNDSQVTADDENESGTAFLIRILKYLETPQYLRKTLFPKHNSLRFVGLLPPLDAPHHLRKHEWAPYREGVTLAQQAPSSGTTLVDVGLSKNVVIDELVEAGRRVTVAMGTNRQLDDEPHEVLTSSKPREKAGMYWGYKVRYAPNITSVFEQSPYKGGYDY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G514650`
TK1151 ID	TkA04G514650
OH-1004 ID	LXL04_039195
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G514650`
Location	Chr04:130049211-130051938 (-)
Description	Similar to Spout1: Putative methyltransferase C9orf114 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_039195` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006364 rRNA processing Biological Process GO:0010608 post-transcriptional regulation of gene expression Biological Process GO:0032259 methylation Biological Process GO:0035196 miRNA processing Biological Process GO:0051301 cell division Biological Process GO:0051661 maintenance of centrosome location Biological Process GO:0070475 rRNA base methylation Biological Process GO:0098900 regulation of action potential Biological Process GO:0000776 kinetochore Cellular Component GO:0005730 nucleolus Cellular Component GO:0005813 centrosome Cellular Component GO:0005819 spindle Cellular Component
KEGG gene cross-reference	cel:CELE_B0361.6 dme:Dmel_CG12128 dre:447888 hsa:51490 mmu:227695 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.913

Rank 1 · TkA04G514650 · TK1151

Cytoplasm0.181

Rank 2 · TkA04G514650 · TK1151

Mitochondrion0.020

Rank 3 · TkA04G514650 · TK1151

Cell membrane0.014

Rank 4 · TkA04G514650 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkA04G514650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13788DUF418030-102 aa

PF02598Methyltrn_RNA_353-340 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G514650	`PF13788`	DUF4180	30	102	0.025	15.3
TkA04G514650	`PF02598`	Methyltrn_RNA_3	53	340	2.3e-108	362.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card