Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1077 bp · LXL04_039195|LXL04_039195|OH1004|cDNA
ATGGCTAAAAAGAAGAGAGATGAAGTGGACGCCGAACCCCAAGTACTCAACCATGGCAATGACGGGTCTCATGACacaaaaaagaagaaaaagaacaaGACAATAGAGAAAGAGCAGAAGAAAGCGTTAGTAGACGATGTCGATATTACTACTCCTACTGTCAGCATCGCCCTTCCTGGCTCTATCATCGATAACACTCAGTCATTCGAGCTCGCTACTCGGCTTGCTGGCCAAATTTCACGTGCCGCCACTATTTTCAG...
1062 bp · LXL04_039195|LXL04_039195|OH1004|CDS
ATGGCTAAAAAGAAGAGAGATGAAGTGGACGCCGAACCCCAAGTACTCAACCATGGCAATGACGGGTCTCATGACACAAAAAAGAAGAAAAAGAACAAGACAATAGAGAAAGAGCAGAAGAAAGCGTTAGTAGACGATGTCGATATTACTACTCCTACTGTCAGCATCGCCCTTCCTGGCTCTATCATCGATAACACTCAGTCATTCGAGCTCGCTACTCGGCTTGCTGGCCAAATTTCACGTGCCGCCACTATTTTCAG...
Protein
Download Protein FASTA353 aa · LXL04_039195|LXL04_039195|OH1004|PROTEIN
MAKKKRDEVDAEPQVLNHGNDGSHDTKKKKKNKTIEKEQKKALVDDVDITTPTVSIALPGSIIDNTQSFELATRLAGQISRAATIFRIDEVVVFDNQSEPSNDSQVTADDENESGTAFLIRILKYLETPQYLRKTLFPKHNSLRFVGLLPPLDAPHHLRKHEWAPYREGVTLAQQAPSSGTTLVDVGLSKNVVIDELVEAGRRVTVAMGTNRQLDDEPHEVVTSSKPREKAGMYWGYKVRYAPNITSVFEQSPYKGGYDY...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_039195 |
|---|---|
| TK1151 ID | TkA04G514650 |
| OH-1004 ID | LXL04_039195 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 99.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_039195 |
|---|---|
| Location | Chr09:62030068-62032458 (-) |
| Description | Similar to Spout1: Putative methyltransferase C9orf114 homolog |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006364 rRNA processing Biological Process GO:0010608 post-transcriptional regulation of gene expression Biological Process GO:0032259 methylation Biological Process GO:0035196 miRNA processing Biological Process GO:0051301 cell division Biological Process GO:0051661 maintenance of centrosome location Biological Process GO:0070475 rRNA base methylation Biological Process GO:0098900 regulation of action potential Biological Process GO:0000776 kinetochore Cellular Component GO:0005730 nucleolus Cellular Component GO:0005813 centrosome Cellular Component GO:0005819 spindle Cellular Component |
| KEGG gene cross-reference | cel:CELE_B0361.6 dme:Dmel_CG12128 dre:447888 hsa:51490 mmu:227695 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF02598.23Methyltrn_RNA_353-340 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_039195 | PF02598.23 | Methyltrn_RNA_3 | 53 | 340 | 1.7e-109 | 366.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.