TkA04G508620 | RubberDandelionOmics

Gene overview

TkA04G508620

Reference: TK1151 Chr: Chr04 Coordinates: 128502936-128510960 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3393 bp · TkA04G508620|TK1151|cDNA

GTTCGGTTTTGCTCAGCTCTAATATTTATTGTCACTAAATAAAAATTTGGAACTAAAAATGACAAAACATGTGGATGTCGATGATGAATCCAGCCCAATTAACGTAAATCCCACGTCGGCGTTCTGTTCGTCGGAACTACAAAAACCCTAGCGGTCATCCGGATCACGACGTCCTTTACTCGTAACGTCATTTTCTTCAGTTTGCTACCAGATCTCAACAAGCAATAAACACAAATAATCTTCCTCCTGAAAATTCAACG...

CDS

Download CDS FASTA

1413 bp · TkA04G508620|TK1151|CDS

ATGCCAACAGGTCACCAAAACATCACCTTACATGATGAGAAAGACCTCACTTTTATTGGGTTGGTTGGAATGCTTGATCCACCAAGGGCGGAAGTAAGAGACGCCATACTTTCATGCATGACAGCTGGCATTCGTGTTATGGTTGTCACAGGGGATAATAAGAATACAGCAGAATCGTTATGCAGAAAGATAGGTGCTTTTGACCACTTGGGTGATTTTGTGGGCCGCTCTTTCACGGCTTCTGAGTTTGAACACCTCCC...

Protein

Download Protein FASTA

470 aa · TkA04G508620|TK1151|PROTEIN

MPTGHQNITLHDEKDLTFIGLVGMLDPPRAEVRDAILSCMTAGIRVMVVTGDNKNTAESLCRKIGAFDHLGDFVGRSFTASEFEHLPASQKTTALQNMALFTRVEPSHKKMLVEALQHQNEVVAMTGDGVNDAPALKKADIGIAMGSGTAVAKSASDMVLADDNFATIVAAVAEGRAIYNNTKQFIRYMISSNIGEVVCIFVAAVLGIPDTLVPVQLLWVNLVTDGLPATAIGFNKQDSDVMKAKPRKVNEAVVTGWLFF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G508620`
TK1151 ID	TkA04G508620
OH-1004 ID	LXL04_039144
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	95.200
Protein coverage (%)	TK1151 97.021 / OH-1004 41.230 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G508620

Location Chr04:128502936-128510960 (+)

Description Similar to ECA3: Calcium-transporting ATPase 3, endoplasmic reticulum-type

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g10130`	This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to an endomembrane compartment (Probable).	ECA3, a Golgi-localized P2A-type ATPase, plays a crucial role in manganese nutrition in Arabidopsis.2008 · DOI: 10.1104/pp.107.110817 A distinct endosomal Ca2+/Mn2+ pump affects root growth through the secretory process.2008 · DOI: 10.1104/pp.108.119909

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_039144 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006816 calcium ion transport Biological Process

GO:0006874 intracellular calcium ion homeostasis Biological Process

GO:0006942 regulation of striated muscle contraction Biological Process

GO:0045988 negative regulation of striated muscle contraction Biological Process

GO:0048364 root development Biological Process

GO:0055071 manganese ion homeostasis Biological Process

GO:0070588 calcium ion transmembrane transport Biological Process

GO:1903515 calcium ion transport from cytosol to endoplasmic reticulum Biological Process

GO:1990036 calcium ion import into sarcoplasmic reticulum Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005768 endosome Cellular Component

KEGG gene cross-reference

aga:1276852

ath:AT1G10130

gga:395707

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.420

Rank 1 · TkA04G508620 · TK1151

Golgi apparatus0.190

Rank 2 · TkA04G508620 · TK1151

Lysosome / Vacuole0.154

Rank 3 · TkA04G508620 · TK1151

Cytoplasm0.128

Rank 4 · TkA04G508620 · TK1151

Cell membrane0.120

Rank 5 · TkA04G508620 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13246Cation_ATPase13-31 aa

PF00702Hydrolase17-140 aa

PF02875Mur_ligase_C18-65 aa

PF08282Hydrolase_331-65 aa

PF12710HAD31-137 aa

PF21110GlxA70-125 aa

PF08282Hydrolase_3111-167 aa

PF02875Mur_ligase_C112-196 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G508620	`PF13246`	Cation_ATPase	13	31	0.0012	19.4
TkA04G508620	`PF00702`	Hydrolase	17	140	4.7e-14	53.9
TkA04G508620	`PF02875`	Mur_ligase_C	18	65	0.27	12.8
TkA04G508620	`PF08282`	Hydrolase_3	31	65	2.2e-08	34.9
TkA04G508620	`PF12710`	HAD	31	137	0.0029	18.7
TkA04G508620	`PF21110`	GlxA	70	125	0.34	12.3
TkA04G508620	`PF08282`	Hydrolase_3	111	167	2.2e-08	34.9
TkA04G508620	`PF02875`	Mur_ligase_C	112	196	0.27	12.8
TkA04G508620	`PF21110`	GlxA	166	183	0.34	12.3
TkA04G508620	`PF00689`	Cation_ATPase_C	211	409	4.4e-46	157.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SY55`	Arabidopsis thaliana	sp\|Q9SY55\|ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type	85.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card