TkA04G488970 | RubberDandelionOmics

Gene overview

TkA04G488970

Reference: TK1151 Chr: Chr04 Coordinates: 123649510-123655052 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3339 bp · TkA04G488970|TK1151|cDNA

AAAAAGGTTAGTGTTTAGATTGTGGTTTGAAGTTAATCAGCTATCTTTAAATACTCCGTCCCGGTAAGCAAATTGACAGCAGAGGGAGACAAACTCAACCGACAAGATGAATCAGCGAAGCCCTAAAAATGGTACTCTTGCACCTGCATTTCTAGTTGCGAGTGAATGAAAGTGACGTTAGGGTTTATATGCATCACAACAATATATAAGCTACAGCTGGTGTAATTGAAATTCAAAAATGGGTGTGGAGCAAGGGAAGA...

CDS

Download CDS FASTA

2904 bp · TkA04G488970|TK1151|CDS

ATGGGTGTGGAGCAAGGGAAGAAGGTGCTGGAGGAAGGATGGTTGGCTGCTCGATCCACCGACGTTGAACTCACCGGAATACAGCTGACGACTACTCATCCTCCTTCTTCCGACACTTCTCTATGGATGCCGGCAGTGATTCCCGGAACTGTTTTGGCAACCCTTTTGAAGAACGATCTCATTCCAGATCCTTTCTATGGGATAAATAATGAAGCAATCATTGACATTGGTGATTCAGGGAGGGAATACTACACCTTTTG...

Protein

Download Protein FASTA

967 aa · TkA04G488970|TK1151|PROTEIN

MGVEQGKKVLEEGWLAARSTDVELTGIQLTTTHPPSSDTSLWMPAVIPGTVLATLLKNDLIPDPFYGINNEAIIDIGDSGREYYTFWFFTTFHCKLSSGQHVDLNFRGINYSAEVYLNGHQIILPKGMFRRHSIDVTDILHPDGDNMLAVLVHPPDHPGTIPPQGGQGGDHEIGKDVTTQYVQGWDWMAPIRDRNTGIWDEVSITVTGPVKIVDPHLVSSFFDGYKRVYLHATAELVNKSATSANCSLKILVSTELEGST...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G488970`
TK1151 ID	TkA04G488970
OH-1004 ID	LXL04_038970
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 99.793 / OH-1004 89.289 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G488970

Location Chr04:123649510-123655052 (+)

Description Similar to EBM: Mannosylglycoprotein endo-beta-mannosidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g09010`	Glycosidase that specifically hydrolyzes the Man-beta-1,4-GlcNAc linkage in the trimannosyl core structure of N-glycans.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038970 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000272 polysaccharide catabolic process Biological Process

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006032 chitin catabolic process Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Molecular Function

GO:0030246 carbohydrate binding Molecular Function

GO:0033947 mannosylglycoprotein endo-beta-mannosidase activity Molecular Function

GO:0052761 exo-1,4-beta-D-glucosaminidase activity Molecular Function

KEGG gene cross-reference

abe:ARB_07888

ag:AAX62629

ath:AT1G09010

sma:SAVERM_1223

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.524

Rank 1 · TkA04G488970 · TK1151

Nucleus0.194

Rank 2 · TkA04G488970 · TK1151

Lysosome / Vacuole0.106

Rank 3 · TkA04G488970 · TK1151

Extracellular0.098

Rank 4 · TkA04G488970 · TK1151

Endoplasmic reticulum0.097

Rank 5 · TkA04G488970 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22666Glyco_hydro_2_N238-199 aa

PF02837Glyco_hydro_2_N83-152 aa

PF00703Glyco_hydro_2210-329 aa

PF02836Glyco_hydro_2_C343-469 aa

PF00703Glyco_hydro_2714-735 aa

PF18368Ig_GlcNase784-834 aa

PF00703Glyco_hydro_2810-842 aa

PF18368Ig_GlcNase913-959 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G488970	`PF22666`	Glyco_hydro_2_N2	38	199	1.9e-27	97.1
TkA04G488970	`PF02837`	Glyco_hydro_2_N	83	152	0.036	14.7
TkA04G488970	`PF00703`	Glyco_hydro_2	210	329	5.3e-11	43.9
TkA04G488970	`PF02836`	Glyco_hydro_2_C	343	469	0.00013	22.0
TkA04G488970	`PF00703`	Glyco_hydro_2	714	735	5.3e-11	43.9
TkA04G488970	`PF18368`	Ig_GlcNase	784	834	4.8e-12	46.6
TkA04G488970	`PF00703`	Glyco_hydro_2	810	842	5.3e-11	43.9
TkA04G488970	`PF18368`	Ig_GlcNase	913	959	4.8e-12	46.6
TkA04G488970	`PF17753`	Ig_mannosidase	920	943	0.0011	19.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q75W54`	Arabidopsis thaliana	sp\|Q75W54\|EBM_ARATH Mannosylglycoprotein endo-beta-mannosidase	68.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card