RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G478230
Reference: TK1151 Chr: Chr04 Coordinates: 120812694-120821183 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

4681 bp · TkA04G478230|TK1151|cDNA

GTTATTTTCCCCATTAAACAACGCTTTTTAATTTATGGATGCGTAATCCATGATGCATTACTTTCACCGCATATGAAGGAAAAAGTCCCTTTATATATTGATTCCATTTAGAGTAAAATTAAAGCTCTAAAAAGCCATCTCAGATGGCTCAGTTAGTTGGTTCCGAAGAGATAGAGTCTCTAAGATATGAGCTTTCGGAGATCGGAAGAAGTATAAGATCATCATTTCGTCGTCATACATCCAGTTTTCGTACAAATTCA...

CDS

Download CDS FASTA

4347 bp · TkA04G478230|TK1151|CDS

ATGGCTCAGTTAGTTGGTTCCGAAGAGATAGAGTCTCTAAGATATGAGCTTTCGGAGATCGGAAGAAGTATAAGATCATCATTTCGTCGTCATACATCCAGTTTTCGTACAAATTCAGAAATAAGTTGTGCAAATGATCAAGAAGAGGCAGATAAGAATCTTCTAGAGTGGGCAGCAATCGATAGATTGCCAACATTTGAACGTTTGAGATCATCTTTGTTTGATGAAGAAAATGGAGATGGAGATAATGGTGGAGGAAA...

Protein

Download Protein FASTA

1448 aa · TkA04G478230|TK1151|PROTEIN

MAQLVGSEEIESLRYELSEIGRSIRSSFRRHTSSFRTNSEISCANDQEEADKNLLEWAAIDRLPTFERLRSSLFDEENGDGDNGGGKKVVDVTKLLPPERHMFMEKLIKHIENDNLQLLQKLRKRTDKVGVQLPTVEVRYKNLRVEAECEVVHGKPLPTLWNSLQSMLSDIVIIPGLKSKRAKITIINDVTGVVKPGRMTLLLGPPGCGKTTLLKALSGNLNKSLKLSGEISYNGYKLDQFVPQKTSAYISQNDLHIPEM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G478230
TK1151 IDTkA04G478230
OH-1004 IDLXL04_038926
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)99.700
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G478230
LocationChr04:120812694-120821183 (+)
DescriptionSimilar to PDR3: Pleiotropic drug resistance protein 3
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g53480 Together with ABCG36, regulates auxin homeostasis and responses by playing a dual role in coumarin (and derivatives) and in the auxin precursor indole 3-butyric acid (IBA) efflux transport, thus influencing roots and root hairs development.
Arabidopsis PIS1 encodes the ABCG37 transporter of auxinic compounds including the auxin precursor indole-3-butyric acid.2010 · DOI: 10.1073/pnas.1005878107
Involvement of the ABCG37 transporter in secretion of scopoletin and derivatives by Arabidopsis roots in response to iron deficiency.2014 · DOI: 10.1111/nph.12471
Arabidopsis Transporter ABCG37/PDR9 contributes primarily highly oxygenated Coumarins to Root Exudation.2017 · DOI: 10.1038/s41598-017-03250-6
At2g37280 May be a general defense protein. No verified direct reference in this release
At4g15215 May be a general defense protein. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os02g0528900 May be a general defense protein. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038926 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009734 auxin-activated signaling pathway Biological Process
GO:0009804 coumarin metabolic process Biological Process
GO:0009926 auxin polar transport Biological Process
GO:0010164 response to cesium ion Biological Process
GO:0018901 2,4-dichlorophenoxyacetic acid metabolic process Biological Process
GO:0048364 root development Biological Process
GO:0055085 transmembrane transport Biological Process
GO:0071366 cellular response to indolebutyric acid stimulus Biological Process
GO:0140352 export from cell Biological Process
GO:0140964 intracellular auxin homeostasis Biological Process
GO:1990641 response to iron ion starvation Biological Process
GO:1990748 cellular detoxification Biological Process
KEGG gene cross-reference
ath:AT2G37280
ath:AT3G53480
ath:AT4G15215
dosa:Os02g0528900
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.525
Rank 1 · TkA04G478230 · TK1151
Lysosome / Vacuole0.174
Rank 2 · TkA04G478230 · TK1151
Endoplasmic reticulum0.163
Rank 3 · TkA04G478230 · TK1151
Cytoplasm0.115
Rank 4 · TkA04G478230 · TK1151
Golgi apparatus0.085
Rank 5 · TkA04G478230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14510ABC_trans_N113-162 aa
PF03205MobB161-188 aa
PF05272VapE-like_dom177-219 aa
PF02367TsaE180-222 aa
PF13175AAA_15182-239 aa
PF03193RsgA_GTPase187-223 aa
PF00005ABC_tran188-369 aa
PF20703nSTAND1188-216 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G478230PF14510ABC_trans_N1131622.1e-0525.5
TkA04G478230PF03205MobB1611880.03114.9
TkA04G478230PF05272VapE-like_dom1772190.3611.0
TkA04G478230PF02367TsaE1802220.003118.2
TkA04G478230PF13175AAA_151822390.006116.9
TkA04G478230PF03193RsgA_GTPase1872231.5e-0525.6
TkA04G478230PF00005ABC_tran1883695.4e-41141.1
TkA04G478230PF20703nSTAND11882160.3911.0
TkA04G478230PF09818ABC_ATPase1882181.88.3
TkA04G478230PF13481AAA_251912161.7e-0525.2
TkA04G478230PF13086AAA_111922220.113.1
TkA04G478230PF12775AAA_71932300.2911.4
TkA04G478230PF00437T2SSE1932240.489.7
TkA04G478230PF25199nSTAND_NTPase51942180.1212.9
TkA04G478230PF13555AAA_291962182.1e-0628.1
TkA04G478230PF13604AAA_301962661.3e-0525.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LFH0Arabidopsis thalianasp|Q9LFH0|AB37G_ARATH ABC transporter G family member 3765.100%Swiss-ProtHigh
Q9ZUT8Arabidopsis thalianasp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 3364.200%Swiss-ProtHigh
Q7PC83Arabidopsis thalianasp|Q7PC83|AB41G_ARATH ABC transporter G family member 4158.900%Swiss-ProtHigh
Q8GU83Oryza sativa subsp. japonicasp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 4160.700%Swiss-ProtHigh

JBrowse

View in Genome Browser