TkA04G457740 | RubberDandelionOmics

Gene overview

TkA04G457740

Reference: TK1151 Chr: Chr04 Coordinates: 115434519-115436554 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1529 bp · TkA04G457740|TK1151|cDNA

AATCCATCCAAAACCGGCAAACTATTTTTTTTACTTTTTATAGAATCATAGAAAGAAAATTTGGACACGCATCTACCCGTGACCATCCCCTGCCGGCTTTCTTAGACAGGCATTAACACGTGAAAAATGACAAAACTACCCTCACTATTTGTGACTTTAAATCCGCCAAACAAGGACACAACCGTCCATACAGTCTATTTTTCTCTCTCTCCGTTTTTTCTATCTCTAAAAATGGTTTCTGTATTCGTATAACTTCCGAA...

CDS

Download CDS FASTA

774 bp · TkA04G457740|TK1151|CDS

ATGGCGTCGTCGAAGGTGATGGCATCATCATCGCCGGCGAATCAGGATCTACAACGTCATCAGGCATTCGCGCATACCGTCGGTCTCACCGATCACAACAACAATTTAATTTCTATGAATATGGACGATATCCTAAAGAACGTTTACGAGGATTCGCGTCAGGCGCCGGGGAGTTTTCCCGCCAGTGGTGGAAAGACGATGGATGAAAGTTGGAAGGAGATCGTGGATGGAAGCGGTGGTGATCCAGAAATGACTCTAGA...

Protein

Download Protein FASTA

257 aa · TkA04G457740|TK1151|PROTEIN

MASSKVMASSSPANQDLQRHQAFAHTVGLTDHNNNLISMNMDDILKNVYEDSRQAPGSFPASGGKTMDESWKEIVDGSGGDPEMTLEDFLTKAGAVREEDVVKLPPVSASAVVSEYSGVVDPIICAGAGAVDAASFQVMPQQHMQFGSAIGTSAGTSGGVRGKRKVVVEDPPVDKATQQKQRRMIKNRESAARSRERKQAYTVELEALVTQLEEEHARLLKEVDELNKERLKQLMKNLVPVLEKRRPPKVLRRTNSM

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G457740`
TK1151 ID	TkA04G457740
OH-1004 ID	LXL04_038706
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G457740

Location Chr04:115434519-115436554 (+)

Description Similar to BZIP12: bZIP transcription factor 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g03970`	Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter.	Isolation and characterization of a fourth Arabidopsis thaliana G-box-binding factor, which has similarities to Fos oncoprotein.1994 · DOI: 10.1073/pnas.91.7.2522
`At2g36270`	Participates in ABA-regulated gene expression during seed development and subsequent vegetative stage by acting as the major mediator of ABA repression of growth.	A postgermination developmental arrest checkpoint is mediated by abscisic acid and requires the ABI5 transcription factor in Arabidopsis.2001 · DOI: 10.1073/pnas.081594298 Regulation of Arabidopsis thaliana Em genes: role of ABI5.2002 · DOI: 10.1046/j.1365-313x.2002.01295.x The homologous ABI5 and EEL transcription factors function antagonistically to fine-tune gene expression during late embryogenesis.2002 · DOI: 10.1105/tpc.000869 Regulation and role of the Arabidopsis abscisic acid-insensitive 5 gene in abscisic acid, sugar, and stress response.2002 · DOI: 10.1104/pp.005793 ABI5 acts downstream of ABI3 to execute an ABA-dependent growth arrest during germination.2002 · DOI: 10.1046/j.1365-313x.2002.01430.x Mitogen-activated protein kinase signaling in postgermination arrest of development by abscisic acid.2002 · DOI: 10.1073/pnas.242607499 Interactions of abscisic acid and sugar signalling in the regulation of leaf senescence.2004 · DOI: 10.1007/s00425-004-1279-5 Transcriptional regulation of ABI3- and ABA-responsive genes including RD29B and RD29A in seeds, germinating embryos, and seedlings of Arabidopsis.2006 · DOI: 10.1007/s11103-005-2418-5 Monomerization of abscisic acid receptors through CARKs-mediated phosphorylation.2022 · DOI: 10.1111/nph.18149
`At2g41070`	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter.	No verified direct reference in this release
`At3g56850`	Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0867300`	Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro.	The bZIP transcription factor OsABF1 is an ABA responsive element binding factor that enhances abiotic stress signaling in rice.2010 · DOI: 10.1007/s11103-009-9592-9 Phosphorylation of D-allose by hexokinase involved in regulation of OsABF1 expression for growth inhibition in Oryza sativa L.2013 · DOI: 10.1007/s00425-013-1853-9

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038706 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0009789 positive regulation of abscisic acid-activated signaling pathway Biological Process

GO:0009845 seed germination Biological Process

GO:0010182 sugar mediated signaling pathway Biological Process

GO:0010187 negative regulation of seed germination Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

KEGG gene cross-reference

ath:AT1G03970

ath:AT2G36270

ath:AT3G56850

dosa:Os01g0867300

dosa:Os06g0211200

osa:4325078

osa:4340462

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · TkA04G457740 · TK1151

Cytoplasm0.091

Rank 2 · TkA04G457740 · TK1151

Cell membrane0.026

Rank 3 · TkA04G457740 · TK1151

Endoplasmic reticulum0.015

Rank 4 · TkA04G457740 · TK1151

Plastid0.009

Rank 5 · TkA04G457740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03131bZIP_Maf34-48 aa

PF10915DUF2709124-220 aa

PF09660DUF2397176-253 aa

PF00170bZIP_1177-237 aa

PF07716bZIP_2178-229 aa

PF03131bZIP_Maf180-233 aa

PF12210Hrs_helical180-246 aa

PF12867DinB_2182-251 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G457740	`PF03131`	bZIP_Maf	34	48	0.0018	19.5
TkA04G457740	`PF10915`	DUF2709	124	220	0.15	12.1
TkA04G457740	`PF09660`	DUF2397	176	253	0.028	14.0
TkA04G457740	`PF00170`	bZIP_1	177	237	2.8e-14	53.7
TkA04G457740	`PF07716`	bZIP_2	178	229	4.4e-11	43.4
TkA04G457740	`PF03131`	bZIP_Maf	180	233	0.0018	19.5
TkA04G457740	`PF12210`	Hrs_helical	180	246	0.051	14.8
TkA04G457740	`PF12867`	DinB_2	182	251	0.18	13.0
TkA04G457740	`PF24904`	RVE6	214	239	0.27	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42777`	Arabidopsis thaliana	sp\|P42777\|GBF4_ARATH G-box-binding factor 4	45.700%	Swiss-Prot	Medium
`Q9SJN0`	Arabidopsis thaliana	sp\|Q9SJN0\|ABI5_ARATH Protein ABSCISIC ACID-INSENSITIVE 5	32.600%	Swiss-Prot	Medium
`Q9C5Q2`	Arabidopsis thaliana	sp\|Q9C5Q2\|AI5L3_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 3	36.300%	Swiss-Prot	Medium
`Q9LES3`	Arabidopsis thaliana	sp\|Q9LES3\|AI5L2_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 2	33.300%	Swiss-Prot	Medium
`Q0JHF1`	Oryza sativa subsp. japonica	sp\|Q0JHF1\|BZP12_ORYSJ bZIP transcription factor 12	35.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card