TkA04G456840 | RubberDandelionOmics

Gene overview

TkA04G456840

Reference: TK1151 Chr: Chr04 Coordinates: 115161940-115170437 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4119 bp · TkA04G456840|TK1151|cDNA

ACTCCATCACCAGCGCTCGAACTTTACCAACCACCACCTCTTCCTCTATTCTGCCAAGCGACGTCTCCCATCTCTCTCGCTTCTTGTGCTCCTTGCGGCTGCTGCTGCTCACCACCGAGGAAGACCACCGTCCGCCACCAGCGCCAGGAAGAAAAGAGTCGCTGGAGGCCTCCTTGTTGCTGTCGTTTCTGTTGGAGAGGAAGAAAAACAGCGGCCGAGAAGAAGGAGCGGCTGGAAAAGCTCCACCTCGCCGGAGGCGG...

CDS

Download CDS FASTA

3861 bp · TkA04G456840|TK1151|CDS

ACTCCATCACCAGCGCTCGAACTTTACCAACCACCACCTCTTCCTCTATTCTGCCAAGCGACGTCTCCCATCTCTCTCGCTTCTTGTGCTCCTTGCGGCTGCTGCTGCTCACCACCGAGGAAGACCACCGTCCGCCACCAGCGCCAGGAAGAAAAGAGTCGCTGGAGGCCTCCTTGTTGCTGTCGTTTCTGTTGGAGAGGAAGAAAAACAGCGGCCGAGAAGAAGGAGCGGCTGGAAAAGCTCCACCTCGCCGGAGGCGG...

Protein

Download Protein FASTA

1286 aa · TkA04G456840|TK1151|PROTEIN

TPSPALELYQPPPLPLFCQATSPISLASCAPCGCCCSPPRKTTVRHQRQEEKSRWRPPCCCRFCWRGRKTAAEKKERLEKLHLAGGGRQTTGNHHKRLHLGYIVLLRLQAMDDVCEGTSISFPKQEEKILKWWTEVKAFETQLEKTKHLPEYIFYDGPPFATGLPHYGHILAGTIKDIVTRYQTMTGHHVTRRFGWDCHGLPVEHEIDMKLGIKSREDVIKMGIANYNEECRSIVTRYVGEWEKVITRTGRWIDFNNDYK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G456840`
TK1151 ID	TkA04G456840
OH-1004 ID	LXL04_038709
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.000
Protein coverage (%)	TK1151 100.000 / OH-1004 87.713 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G456840

Location Chr04:115161940-115170437 (+)

Description Similar to At4g10320: Isoleucine--tRNA ligase, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10320`	Isoleucine--tRNA ligase, cytoplasmic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038709 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006418 tRNA aminoacylation for protein translation Biological Process

GO:0006428 isoleucyl-tRNA aminoacylation Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016020 membrane Cellular Component

GO:0017101 aminoacyl-tRNA synthetase multienzyme complex Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0002161 aminoacyl-tRNA deacylase activity Molecular Function

KEGG gene cross-reference

ath:AT4G10320

hsa:3376

mmu:105148

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.631

Rank 1 · TkA04G456840 · TK1151

Nucleus0.188

Rank 2 · TkA04G456840 · TK1151

Mitochondrion0.157

Rank 3 · TkA04G456840 · TK1151

Peroxisome0.101

Rank 4 · TkA04G456840 · TK1151

Cell membrane0.063

Rank 5 · TkA04G456840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00133tRNA-synt_1128-771 aa

PF09334tRNA-synt_1g159-217 aa

PF01406tRNA-synt_1e164-190 aa

PF09334tRNA-synt_1g485-601 aa

PF01406tRNA-synt_1e709-765 aa

PF09334tRNA-synt_1g721-778 aa

PF00133tRNA-synt_1818-841 aa

PF08264Anticodon_1829-979 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G456840	`PF00133`	tRNA-synt_1	128	771	1e-157	525.9
TkA04G456840	`PF09334`	tRNA-synt_1g	159	217	8.4e-15	55.1
TkA04G456840	`PF01406`	tRNA-synt_1e	164	190	0.0034	17.5
TkA04G456840	`PF09334`	tRNA-synt_1g	485	601	8.4e-15	55.1
TkA04G456840	`PF01406`	tRNA-synt_1e	709	765	0.0034	17.5
TkA04G456840	`PF09334`	tRNA-synt_1g	721	778	8.4e-15	55.1
TkA04G456840	`PF00133`	tRNA-synt_1	818	841	1e-157	525.9
TkA04G456840	`PF08264`	Anticodon_1	829	979	2.8e-29	102.6
TkA04G456840	`PF08264`	Anticodon_1	1103	1142	2.8e-29	102.6
TkA04G456840	`PF19302`	DUF5915	1111	1148	1.3e-05	26.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JLM5`	Arabidopsis thaliana	sp\|F4JLM5\|SYIC_ARATH Isoleucine--tRNA ligase, cytoplasmic	73.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card