LXL04_038709 | RubberDandelionOmics

Gene overview

LXL04_038709

Reference: OH-1004 Chr: Chr09 Coordinates: 48577687-48586412 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4398 bp · LXL04_038709|LXL04_038709|OH1004|cDNA

ATGGATGATGTGTGTGAAGGCACATCCATCTCGTTCCCAAAACAAGAAGTAAAGATATTAAAATGGTGGACTGAAGTGAAAGCATTTAAAACCCAACTTGAAAAAACCAAACACCTACCGGAATACATCTTCTACGATGGCCCTCCATTTGCCACTGGTCTCCCTCACTACGGCCACATCCTAGCTGGCACAATCAAGGACATCGTCACCCGCTACCAGACGATGACGGGGCACCACGTCACACGGCGGTTCGGTTGGGA...

CDS

Download CDS FASTA

4398 bp · LXL04_038709|LXL04_038709|OH1004|CDS

ATGGATGATGTGTGTGAAGGCACATCCATCTCGTTCCCAAAACAAGAAGTAAAGATATTAAAATGGTGGACTGAAGTGAAAGCATTTAAAACCCAACTTGAAAAAACCAAACACCTACCGGAATACATCTTCTACGATGGCCCTCCATTTGCCACTGGTCTCCCTCACTACGGCCACATCCTAGCTGGCACAATCAAGGACATCGTCACCCGCTACCAGACGATGACGGGGCACCACGTCACACGGCGGTTCGGTTGGGA...

Protein

Download Protein FASTA

1465 aa · LXL04_038709|LXL04_038709|OH1004|PROTEIN

MDDVCEGTSISFPKQEVKILKWWTEVKAFKTQLEKTKHLPEYIFYDGPPFATGLPHYGHILAGTIKDIVTRYQTMTGHHVTRRFGWDCHGLPVEHEIDMKLRIKSREDVIKMGIGNYNEECRSIVTRYVGEWEKVITRTGMWIDFKNDYKTMDLNFMESVWKLMHETGLTLEVAAAPLFLTPSPALELYQPPPLPLFCQATSPISLASCAPCGCCSPPRKTTVRHQRQEEKSRWRPPCCCRFCWRGRKTAAEKKERLEKL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038709`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038709

Location Chr09:48577687-48586412 (-)

Description Similar to At4g10320: Isoleucine--tRNA ligase, cytoplasmic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10320`	Isoleucine--tRNA ligase, cytoplasmic.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038709 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006418 tRNA aminoacylation for protein translation Biological Process

GO:0006428 isoleucyl-tRNA aminoacylation Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0048608 reproductive structure development Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0016020 membrane Cellular Component

GO:0017101 aminoacyl-tRNA synthetase multienzyme complex Cellular Component

GO:0070062 extracellular exosome Cellular Component

GO:0000049 tRNA binding Molecular Function

GO:0002161 aminoacyl-tRNA deacylase activity Molecular Function

KEGG gene cross-reference

ath:AT4G10320

hsa:3376

mmu:105148

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.709

Rank 1 · LXL04_038709 · OH-1004

Nucleus0.231

Rank 2 · LXL04_038709 · OH-1004

Mitochondrion0.136

Rank 3 · LXL04_038709 · OH-1004

Peroxisome0.073

Rank 4 · LXL04_038709 · OH-1004

Cell membrane0.064

Rank 5 · LXL04_038709 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00133.29tRNA-synt_118-165 aa

PF09334.18tRNA-synt_1g49-96 aa

PF00133.29tRNA-synt_1307-950 aa

PF09334.18tRNA-synt_1g338-396 aa

PF08264.20Anticodon_11008-1158 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038709	`PF00133.29`	tRNA-synt_1	18	165	2.8e-211	702.3
LXL04_038709	`PF09334.18`	tRNA-synt_1g	49	96	2.1e-21	76.8
LXL04_038709	`PF00133.29`	tRNA-synt_1	307	950	2.8e-211	702.3
LXL04_038709	`PF09334.18`	tRNA-synt_1g	338	396	2.1e-21	76.8
LXL04_038709	`PF08264.20`	Anticodon_1	1008	1158	7.5e-29	101.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4JLM5`	Arabidopsis thaliana	Isoleucine--tRNA ligase, cytoplasmic	73.542%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card