TkA04G455700 | RubberDandelionOmics

Gene overview

TkA04G455700

Reference: TK1151 Chr: Chr04 Coordinates: 114866603-114871900 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1927 bp · TkA04G455700|TK1151|cDNA

TTTCATAATTGGCTTGTGCATTTTGGGGAACTTCGAACCGGCTACAACAGGGAAGGCTTTCTGGTCAAAATGTTCTTAAAACTGCTGATATTCTCAACGAACAGAACTCCAATTTCAGTCGGCCGAAGGTGATATTTAAAGAGTTAAAGTGGAAATAATCCCAGAGGCTATTAAAGAGTAATGGATTCTGTGAGAAGGCAACCTAAGGCTGTTTTCATGGCTTTTGGGACAAAAGGCGATGTGTATCCAATAGCAGCAAT...

CDS

Download CDS FASTA

1521 bp · TkA04G455700|TK1151|CDS

ATGGATTCTGTGAGAAGGCAACCTAAGGCTGTTTTCATGGCTTTTGGGACAAAAGGCGATGTGTATCCAATAGCAGCAATTGCTGCAGCTTTTGCTTGTGAGGAGGTTCAATACCATGTGGTTTTTATAACACATTCTGCACATCATGACTTAATGGAGCATTTAACCACAAAAGAAGTCACATGTTTTCCTGTTTCATCTCCTCCTGCTCTTTCCCCTTCTCAACATAACAACACTTCAGATTGTATGAAGTTGTCATT...

Protein

Download Protein FASTA

506 aa · TkA04G455700|TK1151|PROTEIN

MDSVRRQPKAVFMAFGTKGDVYPIAAIAAAFACEEVQYHVVFITHSAHHDLMEHLTTKEVTCFPVSSPPALSPSQHNNTSDCMKLSFHQQKKKLTRDHRQECILIFENIFGDIPPMEGDLVIINFFALEGWSLAEVFGVRCVVAAPYVVPYSAPSSFERKFKQELPLLYDYLQTAPSDKICWKDVIHWMWPLFTEEWGTWRATQLHLSPLPFTDPVTSHPMWHNRPLSPLLLYGFSKEVVECPGYWPSNVHVCGFWNLPI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G455700`
TK1151 ID	TkA04G455700
OH-1004 ID	LXL04_038727
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G455700`
Location	Chr04:114866603-114871900 (-)
Description	Similar to UGT80B1: Sterol 3-beta-glucosyltransferase UGT80B1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038727` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0005975 carbohydrate metabolic process Biological Process GO:0006914 autophagy Biological Process GO:0009813 flavonoid biosynthetic process Biological Process GO:0009845 seed germination Biological Process GO:0010214 seed coat development Biological Process GO:0015031 protein transport Biological Process GO:0016125 sterol metabolic process Biological Process GO:0016126 sterol biosynthetic process Biological Process GO:0048316 seed development Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component
KEGG gene cross-reference	ath:AT1G43620 ath:AT3G07020 dha:DEHA2E23738g ppa:PAS_chr4_0167 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.559

Rank 1 · TkA04G455700 · TK1151

Nucleus0.234

Rank 2 · TkA04G455700 · TK1151

Mitochondrion0.181

Rank 3 · TkA04G455700 · TK1151

Peroxisome0.123

Rank 4 · TkA04G455700 · TK1151

Cell membrane0.075

Rank 5 · TkA04G455700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03033Glyco_transf_2811-85 aa

PF00534Glycos_transf_134-65 aa

PF00534Glycos_transf_1313-353 aa

PF06722EryCIII-like_C382-494 aa

PF00201UDPGT390-434 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G455700	`PF03033`	Glyco_transf_28	11	85	0.0041	17.9
TkA04G455700	`PF00534`	Glycos_transf_1	34	65	0.028	14.7
TkA04G455700	`PF00534`	Glycos_transf_1	313	353	0.028	14.7
TkA04G455700	`PF06722`	EryCIII-like_C	382	494	1.4e-14	55.0
TkA04G455700	`PF00201`	UDPGT	390	434	0.016	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card