Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1521 bp · LXL04_038727|LXL04_038727|OH1004|cDNA
ATGGATTCTGTGAGAAGGCAACCTAAGGCTGTTTTCATGGCTTTTGGGACAAAAGGCGATGTGTATCCAATAGCAGCAATTGCTGCAGCTTTTGCTTGTGAGGAGGTTCAATACCATGTGGTTTTTATAACACATTCTGCACATCATGACTTAATGGAGCATTTAACCACAAAAGAAGTCACATGTTTTCCTGTTTCATCTCCTCCTGCTCTTTCCCCTTCTCAACATAACAACACTTCAGATTGTATGAAGTTGTCATT...
1521 bp · LXL04_038727|LXL04_038727|OH1004|CDS
ATGGATTCTGTGAGAAGGCAACCTAAGGCTGTTTTCATGGCTTTTGGGACAAAAGGCGATGTGTATCCAATAGCAGCAATTGCTGCAGCTTTTGCTTGTGAGGAGGTTCAATACCATGTGGTTTTTATAACACATTCTGCACATCATGACTTAATGGAGCATTTAACCACAAAAGAAGTCACATGTTTTCCTGTTTCATCTCCTCCTGCTCTTTCCCCTTCTCAACATAACAACACTTCAGATTGTATGAAGTTGTCATT...
Protein
Download Protein FASTA506 aa · LXL04_038727|LXL04_038727|OH1004|PROTEIN
MDSVRRQPKAVFMAFGTKGDVYPIAAIAAAFACEEVQYHVVFITHSAHHDLMEHLTTKEVTCFPVSSPPALSPSQHNNTSDCMKLSFHQQKKKLTRDHRQECILIFENIFGDIPPMEGDLVIINFFALEGWSLAEVFGVRCVVAAPYVVPYSAPSSFERKFKQELPLLYDYLQTAPSDKICWKDVIHWMWPLFTEEWGTWRATQLHLSPLPFTDPVTSHPMWHNRPLSPLLLYGFSKEVVECPGYWPSNVHVCGFWNLPI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_038727 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_038727 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr09:48939638-48942450 (+) | |||||||||
| Description | Similar to UGT80B1: Sterol 3-beta-glucosyltransferase UGT80B1 | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0005975 carbohydrate metabolic process Biological Process GO:0006914 autophagy Biological Process GO:0009813 flavonoid biosynthetic process Biological Process GO:0009845 seed germination Biological Process GO:0010214 seed coat development Biological Process GO:0015031 protein transport Biological Process GO:0016125 sterol metabolic process Biological Process GO:0016126 sterol biosynthetic process Biological Process GO:0048316 seed development Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component | |||||||||
| KEGG gene cross-reference | ath:AT1G43620 ath:AT3G07020 dha:DEHA2E23738g ppa:PAS_chr4_0167 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF06722.19EryCIII-like_C382-494 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_038727 | PF06722.19 | EryCIII-like_C | 382 | 494 | 1.4e-14 | 55.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.