TkA04G453850 | RubberDandelionOmics

Gene overview

TkA04G453850

Reference: TK1151 Chr: Chr04 Coordinates: 114378814-114385093 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2273 bp · TkA04G453850|TK1151|cDNA

CTCATCCCAACCTTTCGGCAACTAAGCTTACTCAACACACCTGCATCCATACCCACACTAGAAATATATTTGCATAGGCGATAAAAAGAATCCAACCACAATGAGTGGGAGGGTTGCTGCGGATCTTGAGATGAAGGATTCAGATGATTGGAGTTTACCTTCTTTACGCCACCAAAACGATGAACTACCCTATGTTCATAAAGTGGGCAAACCTCCAAAACAAGATTTGTTGAAAGAGATCAAAACCGCACTTAAAGAAA...

CDS

Download CDS FASTA

1998 bp · TkA04G453850|TK1151|CDS

ATGAAAGGCGATAAAAAGAATCCAACCACAATGAGTGGGAGGGTTGCTGCGGATCTTGAGATGAAGGATTCAGATGATTGGAGTTTACCTTCTTTACGCCACCAAAACGATGAACTACCCTATGTTCATAAAGTGGGCAAACCTCCAAAACAAGATTTGTTGAAAGAGATCAAAACCGCACTTAAAGAAACTTTTCTTTCCGATGATCCATTGAAGCCTTTTAAGGACCAACCAAGTAAAAGAAAACTCGTTCTTGGATT...

Protein

Download Protein FASTA

665 aa · TkA04G453850|TK1151|PROTEIN

MKGDKKNPTTMSGRVAADLEMKDSDDWSLPSLRHQNDELPYVHKVGKPPKQDLLKEIKTALKETFLSDDPLKPFKDQPSKRKLVLGFQTLFPILQWSRDYSFSKFKGDFIAGCTIASLCIPQDIGYAKLANLDPQYGLYSSFVPPLIYAFMGSSRDIAIGPVAVVSLLLGSMLQDELDPITQKHEYQRLAFTATFFAGVTQATLGFFRLGFLIDFLSHAAIVGFMGGAAVTIALQQLKGLFGIKKFTKKTDVVSVMRSVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G453850`
TK1151 ID	TkA04G453850
OH-1004 ID	LXL04_038661
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.200
Protein coverage (%)	TK1151 98.496 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G453850

Location Chr04:114378814-114385093 (-)

Description Similar to ST2: High affinity sulfate transporter 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22150`	May act as a high-affinity H⁺/sulfate symporter mediating sulfate loading into sieve tubes.	Phloem-localizing sulfate transporter, Sultr1;3, mediates re-distribution of sulfur from source to sink organs in Arabidopsis.2003 · DOI: 10.1104/pp.014712
`At1g78000`	May act as a high-affinity H⁺/sulfate symporter mediating sulfate uptake by plant roots.	Two distinct high-affinity sulfate transporters with different inducibilities mediate uptake of sulfate in Arabidopsis roots.2002 · DOI: 10.1046/j.0960-7412.2001.01231.x Selenate-resistant mutants of Arabidopsis thaliana identify Sultr1;2, a sulfate transporter required for efficient transport of sulfate into roots.2002 · DOI: 10.1046/j.0960-7412.2001.01232.x
`At4g08620`	May act as a high-affinity H⁺/sulfate symporter mediating root sulfate uptake under low-sulfur conditions.	The roles of three functional sulphate transporters involved in uptake and translocation of sulphate in Arabidopsis thaliana.2000 · DOI: 10.1046/j.1365-313x.2000.00768.x Two distinct high-affinity sulfate transporters with different inducibilities mediate uptake of sulfate in Arabidopsis roots.2002 · DOI: 10.1046/j.0960-7412.2001.01231.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038661 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009970 cellular response to sulfate starvation Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1902358 sulfate transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008271 secondary active sulfate transmembrane transporter activity Molecular Function

GO:0015116 sulfate transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G22150

ath:AT1G78000

ath:AT4G08620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.811

Rank 1 · TkA04G453850 · TK1151

Cytoplasm0.126

Rank 2 · TkA04G453850 · TK1151

Endoplasmic reticulum0.057

Rank 3 · TkA04G453850 · TK1151

Lysosome / Vacuole0.052

Rank 4 · TkA04G453850 · TK1151

Mitochondrion0.040

Rank 5 · TkA04G453850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00916Sulfate_transp105-486 aa

PF26273Gly_zipper340-371 aa

PF26273Gly_zipper454-469 aa

PF26273Gly_zipper484-507 aa

PF01740STAS539-654 aa

PF13466STAS_2587-642 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G453850	`PF00916`	Sulfate_transp	105	486	6.2e-140	467.0
TkA04G453850	`PF26273`	Gly_zipper	340	371	7.5	7.0
TkA04G453850	`PF26273`	Gly_zipper	454	469	7.5	7.0
TkA04G453850	`PF26273`	Gly_zipper	484	507	7.5	7.0
TkA04G453850	`PF01740`	STAS	539	654	6.3e-29	100.6
TkA04G453850	`PF13466`	STAS_2	587	642	0.002	19.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FEP7`	Arabidopsis thaliana	sp\|Q9FEP7\|SUT13_ARATH Sulfate transporter 1.3	74.400%	Swiss-Prot	High
`Q9MAX3`	Arabidopsis thaliana	sp\|Q9MAX3\|SUT12_ARATH Sulfate transporter 1.2	73.900%	Swiss-Prot	High
`Q9SAY1`	Arabidopsis thaliana	sp\|Q9SAY1\|SUT11_ARATH Sulfate transporter 1.1	70.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card