LXL04_038661 | RubberDandelionOmics

Gene overview

LXL04_038661

Reference: OH-1004 Chr: Chr09 Coordinates: 47714760-47718356 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2114 bp · LXL04_038661|LXL04_038661|OH1004|cDNA

ATGAAGGCGATAAAAAGAATCCAACCACAATGAGTGGGAGGGTTGCTGCGGATCTTGAGATGAAGGATTCAGATGATTGGAGTTTACCTTCTTTACGCCACCAAAACGATGAACTACCCTATGTTCATAAAGTGGGCAAACCTCCAAAACAAGATTTGTTGAAAGAGATCAAAACCGCACTTAAAGAAACTTTTCTTTCCGATGATCCATTGAAGCCTTTTAAGGACCAACCAAGTAAAAGAAAACTCGTTCTTGGATTT...

CDS

Download CDS FASTA

2085 bp · LXL04_038661|LXL04_038661|OH1004|CDS

ATGAGTGGGAGGGTTGCTGCGGATCTTGAGATGAAGGATTCAGATGATTGGAGTTTACCTTCTTTACGCCACCAAAACGATGAACTACCCTATGTTCATAAAGTGGGCAAACCTCCAAAACAAGATTTGTTGAAAGAGATCAAAACCGCACTTAAAGAAACTTTTCTTTCCGATGATCCATTGAAGCCTTTTAAGGACCAACCAAGTAAAAGAAAACTCGTTCTTGGATTTCAAACCTTGTTTCCAATTCTTCAATGGAG...

Protein

Download Protein FASTA

694 aa · LXL04_038661|LXL04_038661|OH1004|PROTEIN

MSGRVAADLEMKDSDDWSLPSLRHQNDELPYVHKVGKPPKQDLLKEIKTALKETFLSDDPLKPFKDQPSKRKLVLGFQTLFPILQWSRDYSFSKFKGDFIAGCTIASLCIPQDIGYAKLANLDPQYGLYSSFVPPLIYAFMGSSRDIAIGPVAVVSLLLGSMLQDELDPITQKHEYQRLAFTATFFAGVTQATLGFFRLGFLIDFLSHAAIVGFMGGAAVTIALQQLKGLFGIKKFTKKTDVVSVMRSVIQAAHHGWNWQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038661`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038661

Location Chr09:47714760-47718356 (-)

Description Similar to ST2: High affinity sulfate transporter 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g22150`	May act as a high-affinity H⁺/sulfate symporter mediating sulfate loading into sieve tubes.	Phloem-localizing sulfate transporter, Sultr1;3, mediates re-distribution of sulfur from source to sink organs in Arabidopsis.2003 · DOI: 10.1104/pp.014712
`At1g78000`	May act as a high-affinity H⁺/sulfate symporter mediating sulfate uptake by plant roots.	Two distinct high-affinity sulfate transporters with different inducibilities mediate uptake of sulfate in Arabidopsis roots.2002 · DOI: 10.1046/j.0960-7412.2001.01231.x Selenate-resistant mutants of Arabidopsis thaliana identify Sultr1;2, a sulfate transporter required for efficient transport of sulfate into roots.2002 · DOI: 10.1046/j.0960-7412.2001.01232.x
`At4g08620`	May act as a high-affinity H⁺/sulfate symporter mediating root sulfate uptake under low-sulfur conditions.	The roles of three functional sulphate transporters involved in uptake and translocation of sulphate in Arabidopsis thaliana.2000 · DOI: 10.1046/j.1365-313x.2000.00768.x Two distinct high-affinity sulfate transporters with different inducibilities mediate uptake of sulfate in Arabidopsis roots.2002 · DOI: 10.1046/j.0960-7412.2001.01231.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038661 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009970 cellular response to sulfate starvation Biological Process

GO:0055085 transmembrane transport Biological Process

GO:1902358 sulfate transmembrane transport Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008271 secondary active sulfate transmembrane transporter activity Molecular Function

GO:0015116 sulfate transmembrane transporter activity Molecular Function

GO:0015293 symporter activity Molecular Function

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT1G22150

ath:AT1G78000

ath:AT4G08620

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.780

Rank 1 · LXL04_038661 · OH-1004

Cytoplasm0.145

Rank 2 · LXL04_038661 · OH-1004

Endoplasmic reticulum0.064

Rank 3 · LXL04_038661 · OH-1004

Lysosome / Vacuole0.063

Rank 4 · LXL04_038661 · OH-1004

Mitochondrion0.049

Rank 5 · LXL04_038661 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00916.27Sulfate_transp95-476 aa

PF01740.27STAS529-683 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038661	`PF00916.27`	Sulfate_transp	95	476	6.6e-140	466.9
LXL04_038661	`PF01740.27`	STAS	529	683	7.8e-24	84.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FEP7`	Arabidopsis thaliana	Sulfate transporter 1.3	69.585%	Swiss-Prot	strong database homology
`Q9MAX3`	Arabidopsis thaliana	Sulfate transporter 1.2	69.369%	Swiss-Prot	strong database homology
`Q9SAY1`	Arabidopsis thaliana	Sulfate transporter 1.1	65.460%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card