TkA04G442690 | RubberDandelionOmics

Gene overview

TkA04G442690

Reference: TK1151 Chr: Chr04 Coordinates: 111626937-111630951 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2064 bp · TkA04G442690|TK1151|cDNA

TATTTTGTCCGGTTTCCATGTTTTGAACACTTTTCGACTAAAATCCAAGCACTCTTCTTCTACCTATAAATTAACCGGGAACATATCGAACAAAATCAAGAGCATCATCATCCACCTCTGCATATTCTCTCTCCCCATCGCTAGAAAATGATGCGATTACCAATCCGACGAGTGAGAACTTTAAATCCTCAAATTTTTGCCCTAACAAATCGTAATCTATCTACTGCTACTGAGCAATCTGTGAGACACGGCGATCCTCC...

CDS

Download CDS FASTA

1608 bp · TkA04G442690|TK1151|CDS

ATGATGCGATTACCAATCCGACGAGTGAGAACTTTAAATCCTCAAATTTTTGCCCTAACAAATCGTAATCTATCTACTGCTACTGAGCAATCTGTGAGACACGGCGATCCTCCGAAAGTCCCAAACCTGATTGGAGGTAGCTTTGTAAACTCACAATCATCCACTTTTATTGATGTCATAAATCCAGCAACACAACAAGTTGTTTCTCAATTACCATTAACAAAACACGAGGAGTTTAAAGCTGCAGTATCTACAGCCAA...

Protein

Download Protein FASTA

535 aa · TkA04G442690|TK1151|PROTEIN

MMRLPIRRVRTLNPQIFALTNRNLSTATEQSVRHGDPPKVPNLIGGSFVNSQSSTFIDVINPATQQVVSQLPLTKHEEFKAAVSTAKQAFPSWRNTPITTRQRVMLKLQELIRRDMDKLAMNITTEQGKTLKDAQGDVFRGLEVVEHASGMASLQMGEFSSNVSHGIDTYSIREPLGVCAGICPFNFPAMIPLWMFPVAVTCGNTFVLKPSEKDPGASMMLAELAMEAGLPNGVLNIVHGTNDIVNAICDDEDIKAISFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G442690`
TK1151 ID	TkA04G442690
OH-1004 ID	LXL04_038566
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G442690

Location Chr04:111626937-111630951 (+)

Description Similar to ALDH6B2: Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g14170`	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038566 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006210 thymine catabolic process Biological Process

GO:0006573 valine metabolic process Biological Process

GO:0006574 L-valine catabolic process Biological Process

GO:0019484 beta-alanine catabolic process Biological Process

GO:0019859 thymine metabolic process Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004491 methylmalonate-semialdehyde dehydrogenase (acylating, NAD) activity Molecular Function

GO:0005507 copper ion binding Molecular Function

GO:0016790 thiolester hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT2G14170

bta:327692

cel:CELE_F13D12.4

mmu:104776

rno:81708

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.927

Rank 1 · TkA04G442690 · TK1151

Cytoplasm0.074

Rank 2 · TkA04G442690 · TK1151

Nucleus0.050

Rank 3 · TkA04G442690 · TK1151

Cell membrane0.020

Rank 4 · TkA04G442690 · TK1151

Plastid0.015

Rank 5 · TkA04G442690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00171Aldedh48-512 aa

PF05893LuxC168-278 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G442690	`PF00171`	Aldedh	48	512	1.7e-144	482.6
TkA04G442690	`PF05893`	LuxC	168	278	0.058	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WM29`	Arabidopsis thaliana	sp\|Q0WM29\|MMSA_ARATH Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial	82.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card