LXL04_038566 | RubberDandelionOmics

Gene overview

LXL04_038566

Reference: OH-1004 Chr: Chr09 Coordinates: 44192797-44196342 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1617 bp · LXL04_038566|LXL04_038566|OH1004|cDNA

ATGATGCGATTACCAATCCGACGAGTGAGAACTTTAAATCCTCAAATTTTTGCCCTAACAAATCGTAATCTATCTACTGCTACTGAGCAATCTGTGAGACACGGCGATCCTCCGAAAGTCCCAAACCTGATTGGAGGTAGCTTTGTAAACTCACAATCATCCACTTTTATTGATGTCATAAATCCAGCAACACAACAAGTTGTTTCTCAATTACCATTAACAAAACACGAGGAGTTTAAAGCTGCAGTATCTACAGCCAA...

CDS

Download CDS FASTA

1617 bp · LXL04_038566|LXL04_038566|OH1004|CDS

ATGATGCGATTACCAATCCGACGAGTGAGAACTTTAAATCCTCAAATTTTTGCCCTAACAAATCGTAATCTATCTACTGCTACTGAGCAATCTGTGAGACACGGCGATCCTCCGAAAGTCCCAAACCTGATTGGAGGTAGCTTTGTAAACTCACAATCATCCACTTTTATTGATGTCATAAATCCAGCAACACAACAAGTTGTTTCTCAATTACCATTAACAAAACACGAGGAGTTTAAAGCTGCAGTATCTACAGCCAA...

Protein

Download Protein FASTA

538 aa · LXL04_038566|LXL04_038566|OH1004|PROTEIN

MMRLPIRRVRTLNPQIFALTNRNLSTATEQSVRHGDPPKVPNLIGGSFVNSQSSTFIDVINPATQQVVSQLPLTKHEEFKAAVSTAKQAFPSWRNTPITTRQRVMLKLQELIRRDMDKLAMNITTEQGKTLKDAQGDVFRGLEVVEHASGMASLQMGEFSSNVSHGIDTYSIREPLGVCAGICPFNFPAMIPLWMFPVAVTCGNTFVLKPSEKDPGASMMLAELAMEAGLPNGVLNIVHGTNDIVNAICDDEDIKAISFV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038566`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038566

Location Chr09:44192797-44196342 (+)

Description Similar to ALDH6B2: Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g14170`	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038566 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006210 thymine catabolic process Biological Process

GO:0006573 valine metabolic process Biological Process

GO:0006574 L-valine catabolic process Biological Process

GO:0019484 beta-alanine catabolic process Biological Process

GO:0019859 thymine metabolic process Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004491 methylmalonate-semialdehyde dehydrogenase (acylating, NAD) activity Molecular Function

GO:0005507 copper ion binding Molecular Function

GO:0016790 thiolester hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT2G14170

bta:327692

cel:CELE_F13D12.4

mmu:104776

rno:81708

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.923

Rank 1 · LXL04_038566 · OH-1004

Cytoplasm0.076

Rank 2 · LXL04_038566 · OH-1004

Nucleus0.050

Rank 3 · LXL04_038566 · OH-1004

Cell membrane0.019

Rank 4 · LXL04_038566 · OH-1004

Plastid0.015

Rank 5 · LXL04_038566 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00171.28Aldedh48-515 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038566	`PF00171.28`	Aldedh	48	515	1.2e-141	473.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WM29`	Arabidopsis thaliana	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial	81.564%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card