TkA04G442080 | RubberDandelionOmics

Gene overview

TkA04G442080

Reference: TK1151 Chr: Chr04 Coordinates: 111473941-111477882 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2077 bp · TkA04G442080|TK1151|cDNA

CGATCCAATAATGCCATAGCAAAAGCTGCGCACTCTCACTTATAAAGAACCAATCCAAATAGAATCAAGAAAAATTCTCCTATTTCCTCGATCACCATCTTTAAAATTCACATCACCATTAACGCTATCTTCATCAAGAAACAAAAGAAACATCCACGGCTCTTCTTCTTCAAGTCGTTCCAACTACAAACACTTGAAATTGAAGTCAATACCTTGTGTAAAAAAGTCGTGTCCACCGATTTTGCTTGATACCCACATTA...

CDS

Download CDS FASTA

1596 bp · TkA04G442080|TK1151|CDS

ATGGGTGTTGAATCACCGCCTACTAAGGCGGTTGAAAGCCAAGAACCAGACCCTGCTGTTGTTGTTCCTGTAGAGAAAGAGACGGAATCAGACATGGCTAAAACTCCTACTCCCTTACCTGAACCTACTCCTTCCTGGTTCACTCCCAAAAGGCTGCTGGTGATATTCTGTGTGATCAACATGATAAACTATGTGGATCGAGGTGCCATTGCCAGCAATGGCGTTAATGGCAGTCCCAGAGTTTGTACAAAAAGCGGTGT...

Protein

Download Protein FASTA

531 aa · TkA04G442080|TK1151|PROTEIN

MGVESPPTKAVESQEPDPAVVVPVEKETESDMAKTPTPLPEPTPSWFTPKRLLVIFCVINMINYVDRGAIASNGVNGSPRVCTKSGVCSHGSGIQGDFNLSNFKDGVISSAFMVGLLVASPIFASLAKSINPFRLIGVGLSVWTFAAVGCGISIDFWSITICRMLVGVGEASFISLAAPFIDDNAPVTQRTAWLGIFYMCIPTGIALGYVYGGWVGDGFGWRYAFFGEAILMLPFAILGFVMKPLQMKGFSPAGSKKSIT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G442080`
TK1151 ID	TkA04G442080
OH-1004 ID	LXL04_038562
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G442080

Location Chr04:111473941-111477882 (+)

Description Similar to At5g64500: Probable sphingolipid transporter spinster homolog 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64500`	Probable sphingolipid transporter that plays a central role in endosomes and/or lysosomes storage.	No verified direct reference in this release
`At2g22730`	Probable sphingolipid transporter.	No verified direct reference in this release
`At5g65687`	Probable sphingolipid transporter that plays a central role in endosomes and/or lysosomes storage.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038562 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0031902 late endosome membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G22730

ath:AT5G64500

ath:AT5G65687

xla:495202

xtr:100127684

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.354

Rank 1 · TkA04G442080 · TK1151

Cell membrane0.298

Rank 2 · TkA04G442080 · TK1151

Cytoplasm0.253

Rank 3 · TkA04G442080 · TK1151

Golgi apparatus0.156

Rank 4 · TkA04G442080 · TK1151

Endoplasmic reticulum0.120

Rank 5 · TkA04G442080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03137OATP93-147 aa

PF07690MFS_194-441 aa

PF00083Sugar_tr101-470 aa

PF05977MFS_3106-248 aa

PF03137OATP159-395 aa

PF05977MFS_3347-504 aa

PF03137OATP393-461 aa

PF07690MFS_1438-488 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G442080	`PF03137`	OATP	93	147	1.2e-25	90.5
TkA04G442080	`PF07690`	MFS_1	94	441	6.1e-33	114.9
TkA04G442080	`PF00083`	Sugar_tr	101	470	7.3e-07	29.1
TkA04G442080	`PF05977`	MFS_3	106	248	0.0048	16.1
TkA04G442080	`PF03137`	OATP	159	395	1.2e-25	90.5
TkA04G442080	`PF05977`	MFS_3	347	504	0.0048	16.1
TkA04G442080	`PF03137`	OATP	393	461	1.2e-25	90.5
TkA04G442080	`PF07690`	MFS_1	438	488	6.1e-33	114.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLG8`	Arabidopsis thaliana	sp\|Q9FLG8\|SPNS2_ARATH Probable sphingolipid transporter spinster homolog 2	70.800%	Swiss-Prot	High
`F4IKF6`	Arabidopsis thaliana	sp\|F4IKF6\|SPNS3_ARATH Probable sphingolipid transporter spinster homolog 3	69.000%	Swiss-Prot	High
`Q6NMN6`	Arabidopsis thaliana	sp\|Q6NMN6\|SPNS1_ARATH Probable sphingolipid transporter spinster homolog 1	63.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card