LXL04_038562 | RubberDandelionOmics

Gene overview

LXL04_038562

Reference: OH-1004 Chr: Chr09 Coordinates: 43985642-43988816 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1683 bp · LXL04_038562|LXL04_038562|OH1004|cDNA

ATGGGTGTTGAATCACCGCCTACTAAGGCGGTTGAAAGCCAAGAACCAGACCCTGCTGTTGTTGTTCCTGTAGAGAAAGAGACGGAATCAGACATGGCTAAAACTCCTACTCCCTTACCTGAACCTACTCCTTCCTGGTTCACTCCCAAAAGGTACGATCTTGATCTTCAATCTTCATTTTCCTTTTCAACTTCTGTTATCACTAGAGAAGAAACCCAGATGAATGTGGCGGAATTCATGCTGCTGGTGATATTCTGTGT...

CDS

Download CDS FASTA

1683 bp · LXL04_038562|LXL04_038562|OH1004|CDS

ATGGGTGTTGAATCACCGCCTACTAAGGCGGTTGAAAGCCAAGAACCAGACCCTGCTGTTGTTGTTCCTGTAGAGAAAGAGACGGAATCAGACATGGCTAAAACTCCTACTCCCTTACCTGAACCTACTCCTTCCTGGTTCACTCCCAAAAGGTACGATCTTGATCTTCAATCTTCATTTTCCTTTTCAACTTCTGTTATCACTAGAGAAGAAACCCAGATGAATGTGGCGGAATTCATGCTGCTGGTGATATTCTGTGT...

Protein

Download Protein FASTA

560 aa · LXL04_038562|LXL04_038562|OH1004|PROTEIN

MGVESPPTKAVESQEPDPAVVVPVEKETESDMAKTPTPLPEPTPSWFTPKRYDLDLQSSFSFSTSVITREETQMNVAEFMLLVIFCVINMINYVDRGAIASNGVNGSPRVCTKSGVCSHGSGIQGDFNLSNFKDGVISSAFMVGLLVASPIFASLAKSINPFRLIGVGLSVWTFAAVGCGISIDFWSITICRMLVGVGEASFISLAAPFIDDNAPVTQRTAWLGIFYMCIPTGVALGYVYGGWVGDGFGWRYAFFGEAIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038562`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038562

Location Chr09:43985642-43988816 (+)

Description Similar to At5g64500: Probable sphingolipid transporter spinster homolog 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g64500`	Probable sphingolipid transporter that plays a central role in endosomes and/or lysosomes storage.	No verified direct reference in this release
`At2g22730`	Probable sphingolipid transporter.	No verified direct reference in this release
`At5g65687`	Probable sphingolipid transporter that plays a central role in endosomes and/or lysosomes storage.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038562 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005743 mitochondrial inner membrane Cellular Component

GO:0005765 lysosomal membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0031902 late endosome membrane Cellular Component

GO:0022857 transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT2G22730

ath:AT5G64500

ath:AT5G65687

xla:495202

xtr:100127684

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.377

Rank 1 · LXL04_038562 · OH-1004

Cell membrane0.256

Rank 2 · LXL04_038562 · OH-1004

Cytoplasm0.234

Rank 3 · LXL04_038562 · OH-1004

Golgi apparatus0.170

Rank 4 · LXL04_038562 · OH-1004

Endoplasmic reticulum0.131

Rank 5 · LXL04_038562 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07690.22MFS_1123-470 aa

PF00083.31Sugar_tr124-502 aa

PF03137.27OATP188-424 aa

PF03137.27OATP422-490 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038562	`PF07690.22`	MFS_1	123	470	6.4e-33	114.8
LXL04_038562	`PF00083.31`	Sugar_tr	124	502	7.6e-07	29.1
LXL04_038562	`PF03137.27`	OATP	188	424	1.1e-25	90.7
LXL04_038562	`PF03137.27`	OATP	422	490	1.1e-25	90.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FLG8`	Arabidopsis thaliana	Probable sphingolipid transporter spinster homolog 2	65.392%	Swiss-Prot	strong database homology
`F4IKF6`	Arabidopsis thaliana	Probable sphingolipid transporter spinster homolog 3	68.293%	Swiss-Prot	strong database homology
`Q6NMN6`	Arabidopsis thaliana	Probable sphingolipid transporter spinster homolog 1	63.982%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card