TkA04G435390 | RubberDandelionOmics

Gene overview

TkA04G435390

Reference: TK1151 Chr: Chr04 Coordinates: 109794563-109795145 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

372 bp · TkA04G435390|TK1151|cDNA

GGTACTGATACACTTGGAGGTGTAAGAATCCCAGCCTCATTTTGTGGTGTTCTTGGATTCAGGCCTTCACATGGAGTTGTATCCACCATTGGAGTTCTTCCAAATTCACAATCTTTAGACATTGTTGGGATATTTGCACGTAATCCATCTGTATTACATCGTGTTGGACACGTTCTTCTTAGATTAAATCCATTAGAGCCAAGAAGAACAAAACGCATTATTGTGGCGGATGATTTGTTTCAGTTATCTAAAGTTTCTCA...

CDS

Download CDS FASTA

372 bp · TkA04G435390|TK1151|CDS

GGTACTGATACACTTGGAGGTGTAAGAATCCCAGCCTCATTTTGTGGTGTTCTTGGATTCAGGCCTTCACATGGAGTTGTATCCACCATTGGAGTTCTTCCAAATTCACAATCTTTAGACATTGTTGGGATATTTGCACGTAATCCATCTGTATTACATCGTGTTGGACACGTTCTTCTTAGATTAAATCCATTAGAGCCAAGAAGAACAAAACGCATTATTGTGGCGGATGATTTGTTTCAGTTATCTAAAGTTTCTCA...

Protein

Download Protein FASTA

123 aa · TkA04G435390|TK1151|PROTEIN

GTDTLGGVRIPASFCGVLGFRPSHGVVSTIGVLPNSQSLDIVGIFARNPSVLHRVGHVLLRLNPLEPRRTKRIIVADDLFQLSKVSQQKTVYIVSKVTEKLSGYQQPKHMNIGQYIFHQMFWE

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G435390`
TK1151 ID	TkA04G435390
OH-1004 ID	LXL04_017125
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.400
Protein coverage (%)	TK1151 94.309 / OH-1004 11.765 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G435390

Location Chr04:109794563-109795145 (+)

Description Similar to OM64: Outer envelope protein 64, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09420`	Chaperone receptor mediating Hsp90-dependent protein targeting to mitochondria.	No verified direct reference in this release
`At3g17970`	Chaperone receptor mediating Hsp90-dependent protein targeting to chloroplasts.	Toc64/OEP64 is not essential for the efficient import of proteins into chloroplasts in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03207.x
`At1g08980`	Amidase involved in auxin biosynthesis.	Molecular cloning and characterization of an amidase from Arabidopsis thaliana capable of converting indole-3-acetamide into the plant growth hormone, indole-3-acetic acid.2003 · DOI: 10.1016/s0031-9422(02)00563-0 Characterization of Four Bifunctional Plant IAM/PAM-Amidohydrolases Capable of Contributing to Auxin Biosynthesis.2014 · DOI: 10.3390/plants3030324

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017125 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006626 protein targeting to mitochondrion Biological Process

GO:0009684 indoleacetic acid biosynthetic process Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0015031 protein transport Biological Process

GO:0030150 protein import into mitochondrial matrix Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G08980

ath:AT3G17970

ath:AT5G09420

dosa:Os04g0118100

osa:4334958

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.347

Rank 1 · TkA04G435390 · TK1151

Mitochondrion0.301

Rank 2 · TkA04G435390 · TK1151

Nucleus0.235

Rank 3 · TkA04G435390 · TK1151

Cell membrane0.075

Rank 4 · TkA04G435390 · TK1151

Plastid0.071

Rank 5 · TkA04G435390 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01425Amidase1-73 aa

PF01637ATPase_263-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G435390	`PF01425`	Amidase	1	73	1.3e-16	61.5
TkA04G435390	`PF01637`	ATPase_2	63	106	0.2	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KCL7`	Arabidopsis thaliana	sp\|F4KCL7\|OE64M_ARATH Outer envelope protein 64, mitochondrial	61.200%	Swiss-Prot	High
`Q9LVH5`	Arabidopsis thaliana	sp\|Q9LVH5\|OE64C_ARATH Outer envelope protein 64, chloroplastic	51.700%	Swiss-Prot	High
`Q9FR37`	Arabidopsis thaliana	sp\|Q9FR37\|AMI1_ARATH Amidase 1	48.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card