LXL04_017125 | RubberDandelionOmics

Gene overview

LXL04_017125

Reference: OH-1004 Chr: Chr03 Coordinates: 141545990-141552541 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2961 bp · LXL04_017125|LXL04_017125|OH1004|cDNA

ATGTCGTTAAAAGCTATAAACCTTGAGAAAGTCAAAACCCATGTCTCAAACCCAAAAGTATGGATCGTGATCGGCGTCAGCGTCGCCGGCATATTGATCCTCACCGCAGAGACTCGGAGGCGCCGATTAAAAGGTAGGTATGCGATAAAAGAAGACTATGGTGCTTTTATAGAGCGGTTCGAGTTACTTCCATTTCCTCAGCCGCCTCCTCCCGCCGCAAAACAGCCTCTTTCTGGCCTAACTTTCGCCATCAGCGACGT...

CDS

Download CDS FASTA

2961 bp · LXL04_017125|LXL04_017125|OH1004|CDS

ATGTCGTTAAAAGCTATAAACCTTGAGAAAGTCAAAACCCATGTCTCAAACCCAAAAGTATGGATCGTGATCGGCGTCAGCGTCGCCGGCATATTGATCCTCACCGCAGAGACTCGGAGGCGCCGATTAAAAGGTAGGTATGCGATAAAAGAAGACTATGGTGCTTTTATAGAGCGGTTCGAGTTACTTCCATTTCCTCAGCCGCCTCCTCCCGCCGCAAAACAGCCTCTTTCTGGCCTAACTTTCGCCATCAGCGACGT...

Protein

Download Protein FASTA

986 aa · LXL04_017125|LXL04_017125|OH1004|PROTEIN

MSLKAINLEKVKTHVSNPKVWIVIGVSVAGILILTAETRRRRLKGRYAIKEDYGAFIERFELLPFPQPPPPAAKQPLSGLTFAISDVFDVKEYVTGFGNPDWKRTHEEAGKTAIVVTTLLKDGATCVGRTVMDELSFGTTGENSHYGTPTSPAMPSYIPGGSSSGSAVAVAAELVDFSIGTDTLGGVRIPASFCGVLGFRPSHGVVSTIGVLPNSQSLDTVGIFARDPSVLHRVGHVLLRLNPLEPRRTKRIIVADDLFQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017125`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017125

Location Chr03:141545990-141552541 (+)

Description Similar to OM64: Outer envelope protein 64, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g09420`	Chaperone receptor mediating Hsp90-dependent protein targeting to mitochondria.	No verified direct reference in this release
`At3g17970`	Chaperone receptor mediating Hsp90-dependent protein targeting to chloroplasts.	Toc64/OEP64 is not essential for the efficient import of proteins into chloroplasts in Arabidopsis thaliana.2007 · DOI: 10.1111/j.1365-313x.2007.03207.x
`At1g08980`	Amidase involved in auxin biosynthesis.	Molecular cloning and characterization of an amidase from Arabidopsis thaliana capable of converting indole-3-acetamide into the plant growth hormone, indole-3-acetic acid.2003 · DOI: 10.1016/s0031-9422(02)00563-0 Characterization of Four Bifunctional Plant IAM/PAM-Amidohydrolases Capable of Contributing to Auxin Biosynthesis.2014 · DOI: 10.3390/plants3030324

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0118100`	Amidase involved in auxin biosynthesis (Probable).	Characterization of Four Bifunctional Plant IAM/PAM-Amidohydrolases Capable of Contributing to Auxin Biosynthesis.2014 · DOI: 10.3390/plants3030324

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017125 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006626 protein targeting to mitochondrion Biological Process

GO:0009684 indoleacetic acid biosynthetic process Biological Process

GO:0009851 auxin biosynthetic process Biological Process

GO:0015031 protein transport Biological Process

GO:0030150 protein import into mitochondrial matrix Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005741 mitochondrial outer membrane Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G08980

ath:AT3G17970

ath:AT5G09420

dosa:Os04g0118100

osa:4334958

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.346

Rank 1 · LXL04_017125 · OH-1004

Cytoplasm0.345

Rank 2 · LXL04_017125 · OH-1004

Nucleus0.231

Rank 3 · LXL04_017125 · OH-1004

Peroxisome0.105

Rank 4 · LXL04_017125 · OH-1004

Cell membrane0.076

Rank 5 · LXL04_017125 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01425.27Amidase73-460 aa

PF25575.1TPR_BSK1_C492-559 aa

PF00515.35TPR_1494-526 aa

PF07719.24TPR_2494-526 aa

PF13414.13TPR_11500-541 aa

PF07719.24TPR_2528-560 aa

PF00515.35TPR_1529-560 aa

PF28509.1DUF8418665-703 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017125	`PF01425.27`	Amidase	73	460	1.7e-57	196.1
LXL04_017125	`PF25575.1`	TPR_BSK1_C	492	559	9.1e-06	26.3
LXL04_017125	`PF00515.35`	TPR_1	494	526	1.1e-15	57.4
LXL04_017125	`PF07719.24`	TPR_2	494	526	2.6e-13	49.7
LXL04_017125	`PF13414.13`	TPR_11	500	541	2.4e-10	40.7
LXL04_017125	`PF07719.24`	TPR_2	528	560	2.6e-13	49.7
LXL04_017125	`PF00515.35`	TPR_1	529	560	1.1e-15	57.4
LXL04_017125	`PF28509.1`	DUF8418	665	703	4.5e-18	65.4
LXL04_017125	`PF04827.21`	Plant_tran	773	846	5.4e-39	134.7
LXL04_017125	`PF13359.13`	DDE_Tnp_4	779	908	5.4e-12	46.3
LXL04_017125	`PF04827.21`	Plant_tran	846	916	5.4e-39	134.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KCL7`	Arabidopsis thaliana	Outer envelope protein 64, mitochondrial	64.333%	Swiss-Prot	moderate database homology
`Q9LVH5`	Arabidopsis thaliana	Outer envelope protein 64, chloroplastic	53.901%	Swiss-Prot	moderate database homology
`Q9FR37`	Arabidopsis thaliana	Amidase 1	51.300%	Swiss-Prot	weak database homology
`Q7XTK3`	Oryza sativa subsp. japonica	Amidase 1	47.518%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card