RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G432990
Reference: TK1151 Chr: Chr04 Coordinates: 109168138-109169833 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1087 bp · TkA04G432990|TK1151|cDNA

CAACCAATTCGTGACTTTTCCTTCTCCTTTCCCACGCATCAGAAAACACTCTGCATTTTCCATCGAGTTTACTTTGACCATATAATTTCTCCTCCATTGAACACTGTTTCCGCTCTCATCTTCTTCATAACCCCAACCCAAATTCCTTCATTTCTAATAAGAATGGCGCCTTTTAACTTCCCATTGTTCGTACTTACAATCTCACTGTCTCTCGTTCCCATATTATGCACCAACTCCGAAGGTAATGCCTTGCATGCTCT...

CDS

Download CDS FASTA

801 bp · TkA04G432990|TK1151|CDS

CAACCAATTCGTGACTTTTCCTTCTCCTTTCCCACGCATCAGAAAACACTCTGCATTTTCCATCGAGTTTACTTTGACCATATAATTTCTCCTCCATTGAACACTGTTTCCGCTCTCATCTTCTTCATAACCCCAACCCAAATTCCTTCATTTCTAATAAGAATGGCGCCTTTTAACTTCCCATTGTTCGTACTTACAATCTCACTGTCTCTCGTTCCCATATTATGCACCAACTCCGAAGGTAATGCCTTGCATGCTCT...

Protein

Download Protein FASTA

266 aa · TkA04G432990|TK1151|PROTEIN

QPIRDFSFSFPTHQKTLCIFHRVYFDHIISPPLNTVSALIFFITPTQIPSFLIRMAPFNFPLFVLTISLSLVPILCTNSEGNALHALRSKLSDPKNVLQSWDPTLVNPCTWFHVTCDDNSHVIRLDLGNSNISGSLGSELGELKHLQYLELYWNNIGGKIPKELGNLKNLVSMDLYGNKFEGEIPKSFSKLKSLRFLRLNNNKLSGPIPRELTTLSNLKIFDVSNNNLCGTIPVDGPFTSFPMESFQNNRLNGPELQGLV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G432990
TK1151 IDTkA04G432990
OH-1004 IDLXL04_038468
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)99.600
Protein coverage (%)TK1151 87.970 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G432990
LocationChr04:109168138-109169833 (+)
DescriptionSimilar to LRR2: Leucine-rich repeat protein 2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g43740 Probably involved in plant defense response. No verified direct reference in this release
At5g21090 Involved in plant defense response.
A novel simple extracellular leucine-rich repeat (eLRR) domain protein from rice (OsLRR1) enters the endosomal pathway and interacts with the hypersensitive-induced reaction protein 1 (OsHIR1).2009 · DOI: 10.1111/j.1365-3040.2009.02039.x
At1g34210 Serine/threonine-kinase involved in brassinosteroid-dependent and -independent signaling pathways.
Arabidopsis SOMATIC EMBRYOGENESIS RECEPTOR KINASE proteins serve brassinosteroid-dependent and -independent signaling pathways.2008 · DOI: 10.1104/pp.108.123216

Rice

Reference gene IDPossible functionPapers / DOI
UniProt: B8ABC2 Involved in plant defense response. No verified direct reference in this release
Os01g0809300 Involved in plant defense response.
A novel simple extracellular leucine-rich repeat (eLRR) domain protein from rice (OsLRR1) enters the endosomal pathway and interacts with the hypersensitive-induced reaction protein 1 (OsHIR1).2009 · DOI: 10.1111/j.1365-3040.2009.02039.x
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038468 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0007165 signal transduction Biological Process
GO:0009742 brassinosteroid mediated signaling pathway Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0031901 early endosome membrane Cellular Component
GO:0031902 late endosome membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0015026 coreceptor activity Molecular Function
KEGG gene cross-reference
ath:AT3G43740
ath:AT5G21090
dosa:Os01g0809300
dosa:Os08g0174700
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.290
Rank 1 · TkA04G432990 · TK1151
Extracellular0.196
Rank 2 · TkA04G432990 · TK1151
Endoplasmic reticulum0.196
Rank 3 · TkA04G432990 · TK1151
Cytoplasm0.116
Rank 4 · TkA04G432990 · TK1151
Lysosome / Vacuole0.083
Rank 5 · TkA04G432990 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263LRRNT_278-117 aa
PF13855LRR_8118-156 aa
PF13516LRR_6119-134 aa
PF12799LRR_4122-155 aa
PF00560LRR_1123-143 aa
PF25019LRR_R13L1-DRL21124-151 aa
PF23598LRR_14125-225 aa
PF25013LRR_Zer-1140-230 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G432990PF08263LRRNT_2781172.8e-1144.2
TkA04G432990PF13855LRR_81181561e-0938.7
TkA04G432990PF13516LRR_61191340.009316.7
TkA04G432990PF12799LRR_41221555e-0936.8
TkA04G432990PF00560LRR_11231432.7e-1656.9
TkA04G432990PF25019LRR_R13L1-DRL211241510.01216.2
TkA04G432990PF23598LRR_141252254.8e-1452.6
TkA04G432990PF25013LRR_Zer-11402300.02415.5
TkA04G432990PF12799LRR_41441795e-0936.8
TkA04G432990PF13516LRR_61441590.009316.7
TkA04G432990PF25019LRR_R13L1-DRL211442010.01216.2
TkA04G432990PF00560LRR_11451672.7e-1656.9
TkA04G432990PF24141LRR_ComC1582330.03914.3
TkA04G432990PF23211LRR_LRWD11612050.05613.9
TkA04G432990PF13855LRR_81652041e-0938.7
TkA04G432990PF12799LRR_41682055e-0936.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q6NQP4Arabidopsis thalianasp|Q6NQP4|LRR2_ARATH Leucine-rich repeat protein 277.800%Swiss-ProtHigh
Q9FPJ5Arabidopsis thalianasp|Q9FPJ5|LRR1_ARATH Leucine-rich repeat protein 175.900%Swiss-ProtHigh
Q9XIC7Arabidopsis thalianasp|Q9XIC7|SERK2_ARATH Somatic embryogenesis receptor kinase 268.100%Swiss-ProtLow
B8ABC2Oryza sativa subsp. indicasp|B8ABC2|LRR1_ORYSI Leucine-rich repeat protein 178.900%Swiss-ProtHigh
Q5VQP7Oryza sativa subsp. japonicasp|Q5VQP7|LRR1_ORYSJ Leucine-rich repeat protein 178.900%Swiss-ProtHigh

JBrowse

View in Genome Browser