LXL04_038468 | RubberDandelionOmics

Gene overview

LXL04_038468

Reference: OH-1004 Chr: Chr09 Coordinates: 41937780-41939185 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

801 bp · LXL04_038468|LXL04_038468|OH1004|cDNA

CAACCAATTCGTGACTTTTCCTTCTCCTTTCCCACGCATCAGAAAACACTCTGCATTTTCCATCGAGTTTACTTTGACCATATAATTTCTCCTCCATTGAACACTGTTTCCGCTCTCATCTTCTTCATAACCCCAACCCAAATTCCTTCATTTCTAATAAGAATGGCGCCTTTTAACTTCCCATTGTTCGTACTTACAATCTCACTGTCTCTCGTTCCCATATTATGCACCAACTCCGAAGGTAATGCCTTGCATGCTCT...

CDS

Download CDS FASTA

705 bp · LXL04_038468|LXL04_038468|OH1004|CDS

TTGAACACTGTTTCCGCTCTCATCTTCTTCATAACCCCAACCCAAATTCCTTCATTTCTAATAAGAATGGCGCCTTTTAACTTCCCATTGTTCGTACTTACAATCTCACTGTCTCTCGTTCCCATATTATGCACCAACTCCGAAGGTAATGCCTTGCATGCTCTTAGAAGCAAACTTTCTGACCCCAAAAACGTCTTACAGAGCTGGGATCCTACCCTTGTAAATCCTTGTACCTGGTTCCATGTTACCTGCGATGATAA...

Protein

Download Protein FASTA

234 aa · LXL04_038468|LXL04_038468|OH1004|PROTEIN

MNTVSALIFFITPTQIPSFLIRMAPFNFPLFVLTISLSLVPILCTNSEGNALHALRSKLSDPKNVLQSWDPTLVNPCTWFHVTCDDNSHVIRLDLGNSNISGSLGSELGELKHLQYLELYWNNIGGKIPKELGNLKNLVSMDLYGNKFEGEIPKSFSKLKSLRFLRLNNNKLSGPIPRELTTLSNLKIFDVSNNNLCGTIPVDGPFTSFPMESFQNNRLNGPELQGLVSYDFGC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038468`
TK1151 ID	TkA04G432990
OH-1004 ID	LXL04_038468
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.600
Protein coverage (%)	TK1151 87.970 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038468

Location Chr09:41937780-41939185 (+)

Description Similar to LRR2: Leucine-rich repeat protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g43740`	Probably involved in plant defense response.	No verified direct reference in this release
`At5g21090`	Involved in plant defense response.	A novel simple extracellular leucine-rich repeat (eLRR) domain protein from rice (OsLRR1) enters the endosomal pathway and interacts with the hypersensitive-induced reaction protein 1 (OsHIR1).2009 · DOI: 10.1111/j.1365-3040.2009.02039.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0809300`	Involved in plant defense response.	A novel simple extracellular leucine-rich repeat (eLRR) domain protein from rice (OsLRR1) enters the endosomal pathway and interacts with the hypersensitive-induced reaction protein 1 (OsHIR1).2009 · DOI: 10.1111/j.1365-3040.2009.02039.x
`UniProt: B8ABC2`	Involved in plant defense response.	No verified direct reference in this release
`Os08g0174700`	LRR receptor kinase involved in defense response.	Engineering OsBAK1 gene as a molecular tool to improve rice architecture for high yield.2009 · DOI: 10.1111/j.1467-7652.2009.00444.x A subset of OsSERK genes, including OsBAK1, affects normal growth and leaf development of rice.2011 · DOI: 10.1007/s10059-011-0178-4

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038468 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0007165 signal transduction Biological Process

GO:0009742 brassinosteroid mediated signaling pathway Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0031901 early endosome membrane Cellular Component

GO:0031902 late endosome membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0015026 coreceptor activity Molecular Function

KEGG gene cross-reference

ath:AT3G43740

ath:AT5G21090

dosa:Os01g0809300

dosa:Os08g0174700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.384

Rank 1 · LXL04_038468 · OH-1004

Extracellular0.203

Rank 2 · LXL04_038468 · OH-1004

Endoplasmic reticulum0.151

Rank 3 · LXL04_038468 · OH-1004

Cytoplasm0.091

Rank 4 · LXL04_038468 · OH-1004

Lysosome / Vacuole0.068

Rank 5 · LXL04_038468 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_246-85 aa

PF23598.2LRR_1493-193 aa

PF13855.13LRR_8133-172 aa

PF12799.14LRR_4136-173 aa

PF12799.14LRR_4160-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038468	`PF08263.18`	LRRNT_2	46	85	2.3e-11	44.5
LXL04_038468	`PF23598.2`	LRR_14	93	193	3.7e-14	53.0
LXL04_038468	`PF13855.13`	LRR_8	133	172	9e-10	38.9
LXL04_038468	`PF12799.14`	LRR_4	136	173	6.5e-09	36.5
LXL04_038468	`PF12799.14`	LRR_4	160	200	6.5e-09	36.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NQP4`	Arabidopsis thaliana	Leucine-rich repeat protein 2	66.995%	Swiss-Prot	strong database homology
`Q9FPJ5`	Arabidopsis thaliana	Leucine-rich repeat protein 1	62.736%	Swiss-Prot	strong database homology
`Q5VQP7`	Oryza sativa subsp. japonica	Leucine-rich repeat protein 1	66.842%	Swiss-Prot	strong database homology
`B8ABC2`	Oryza sativa subsp. indica	Leucine-rich repeat protein 1	66.842%	Swiss-Prot	strong database homology
`Q6Z4U4`	Oryza sativa subsp. japonica	LRR receptor kinase BAK1	58.128%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card