TkA04G426010 | RubberDandelionOmics

Gene overview

TkA04G426010

Reference: TK1151 Chr: Chr04 Coordinates: 107503160-107506853 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2287 bp · TkA04G426010|TK1151|cDNA

ATTTGGTCCTATATTTTTGGTCGTTGCCTTTTCGAAAGAACCCTGTCGCAATTGGTAAAAACCCCAAATCATACATTCTCTCTCCCGATACTCTCATTTTCAGTGAATCAGGCCCTCTTGCTCCACCGAGATCGCCGACTAGTGACCGCCGTATTGTGCAGCCGTGTAGACTCAGGCGAGGCATTGAAACGTCTAGTGATGGTACTGCTGTTACTATCCTGATTGTACGTTTGGTAATGAGAAATTAGCTTCATGGTAAT...

CDS

Download CDS FASTA

1812 bp · TkA04G426010|TK1151|CDS

ATGGACAAACACATCCAAGACTGCCCATACCCCGGATGCTTCTTCTGTGTCATGAAAGAAGGAAACCCAAACAAACGAAGATCCAGCATCATGAAATTCTTCAGAGAACTCCCTTCACAAGACGATGATGGTCAAGTCCTCCCCATATCTGGTCTCTGGAACACCGCCATGGCGCACCCAAACGACCCCGAATTCATCGAACTAGGCATCTTCGAATGCATGTCAGCACTCATCTGGAAAGGCCTCAAAAACCGCAGATG...

Protein

Download Protein FASTA

603 aa · TkA04G426010|TK1151|PROTEIN

MDKHIQDCPYPGCFFCVMKEGNPNKRRSSIMKFFRELPSQDDDGQVLPISGLWNTAMAHPNDPEFIELGIFECMSALIWKGLKNRRWLSHDQNIYIPYYAAHIIGSYTMNMEDFAETAVNAGVIPPLVELLRGRLTWVEQRVAVRALGHLATYATTFPSVANHGEILELCIQLAMSSLEIVYSHFYQYSDRRLSYHCDLLTRGMGGVEMESRKAEEWASQLQCWSLQLINCFAFKPEFLSVICKPEFIVKLPGMWGGLVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G426010`
TK1151 ID	TkA04G426010
OH-1004 ID	LXL04_038413
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 93.367 / OH-1004 86.350 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G426010`
Location	Chr04:107503160-107506853 (+)
Description	Similar to Tomm34: Mitochondrial import receptor subunit TOM34
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038413` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006457 protein folding Biological Process GO:0006626 protein targeting to mitochondrion Biological Process GO:0070098 chemokine-mediated signaling pathway Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005741 mitochondrial outer membrane Cellular Component GO:0005778 peroxisomal membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0016020 membrane Cellular Component GO:0030674 protein-macromolecule adaptor activity Molecular Function GO:0031072 heat shock protein binding Molecular Function
KEGG gene cross-reference	hsa:10953 hsa:7265 mmu:67145 rno:311621 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.478

Rank 1 · TkA04G426010 · TK1151

Nucleus0.433

Rank 2 · TkA04G426010 · TK1151

Cell membrane0.105

Rank 3 · TkA04G426010 · TK1151

Endoplasmic reticulum0.052

Rank 4 · TkA04G426010 · TK1151

Lysosome / Vacuole0.051

Rank 5 · TkA04G426010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26524ARM_77-244 aa

PF24768ARM_ARMC5112-188 aa

PF00514Arm116-132 aa

PF00514Arm140-151 aa

PF26535DSRM_CARF152-203 aa

PF24768ARM_ARMC5268-326 aa

PF26524ARM_7288-325 aa

PF00514Arm288-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G426010	`PF26524`	ARM_7	7	244	4.8e-117	390.3
TkA04G426010	`PF24768`	ARM_ARMC5	112	188	0.0076	16.4
TkA04G426010	`PF00514`	Arm	116	132	0.00078	20.1
TkA04G426010	`PF00514`	Arm	140	151	0.00078	20.1
TkA04G426010	`PF26535`	DSRM_CARF	152	203	0.23	12.2
TkA04G426010	`PF24768`	ARM_ARMC5	268	326	0.0076	16.4
TkA04G426010	`PF26524`	ARM_7	288	325	4.8e-117	390.3
TkA04G426010	`PF00514`	Arm	288	301	0.00078	20.1
TkA04G426010	`PF00514`	Arm	307	327	0.00078	20.1
TkA04G426010	`PF25575`	TPR_BSK1_C	411	480	0.0065	17.1
TkA04G426010	`PF07719`	TPR_2	416	442	2.3e-06	28.0
TkA04G426010	`PF00515`	TPR_1	418	442	0.0011	19.4
TkA04G426010	`PF13424`	TPR_12	418	439	0.035	15.0
TkA04G426010	`PF13414`	TPR_11	418	442	0.049	14.0
TkA04G426010	`PF13424`	TPR_12	451	506	0.035	15.0
TkA04G426010	`PF07719`	TPR_2	452	479	2.3e-06	28.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card