TkA04G424220 | RubberDandelionOmics

Gene overview

TkA04G424220

Reference: TK1151 Chr: Chr04 Coordinates: 106977398-106988407 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1313 bp · TkA04G424220|TK1151|cDNA

TCCACAAGAGATTTTTCCTATATATATATGAAACGTAGAATACATGTGTTACAAAACATATTTGACAAGTCCAAGATAAGAATAAAAAATTAAAGGAACATACATTATGGCTAAATCTGAATCGCAGGTCCCTGAGTGCATTGAGAAAGTAATTGTTCACACCTTTGGCAAAAAATTTCGTACCTCCACAAGCATAGTTCGTTCACCTTTGAGATTGCCGATCAAGCCAGATCATGTCCTCATAAAAATCATATACGCTG...

CDS

Download CDS FASTA

1056 bp · TkA04G424220|TK1151|CDS

ATGGCTAAATCTGAATCGCAGGTCCCTGAGTGCATTGAGAAAGTAATTGTTCACACCTTTGGCAAAAAATTTCGTACCTCCACAAGCATAGTTCGTTCACCTTTGAGATTGCCGATCAAGCCAGATCATGTCCTCATAAAAATCATATACGCTGGTGTCAATGCAGGCGATGTGAATTGTAGTTCTGGTCAATATTCCAAATACCACGGTGAATCTCAACTTCCTTTTGATGCTGGACTTGAGGGAGTAGGAATAATCGC...

Protein

Download Protein FASTA

351 aa · TkA04G424220|TK1151|PROTEIN

MAKSESQVPECIEKVIVHTFGKKFRTSTSIVRSPLRLPIKPDHVLIKIIYAGVNAGDVNCSSGQYSKYHGESQLPFDAGLEGVGIIAAVGDGVKELKLGAPAAVLVDGGAYANFTMVPSESIMLIEKPDPEAVAMLISGLTSSISLEKSAQMGSGKTILVTAAAGGTGQFAIQLAKLARNKVVATCGGKDKATLLCDLGVDRVINYTEESIKIVLAKEFPEGVDIVYELVGGEMFDLCFNALGVYGRMVVIGMISQYQAE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G424220`
TK1151 ID	TkA04G424220
OH-1004 ID	LXL04_038386
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	71.700
Protein coverage (%)	TK1151 97.721 / OH-1004 54.416 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G424220`
Location	Chr04:106977398-106988407 (-)
Description	Similar to Zadh2: Prostaglandin reductase-3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038386` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006629 lipid metabolic process Biological Process GO:0007567 parturition Biological Process GO:0030728 ovulation Biological Process GO:0032355 response to estradiol Biological Process GO:0032496 response to lipopolysaccharide Biological Process GO:0045471 response to ethanol Biological Process GO:0045786 negative regulation of cell cycle Biological Process GO:0070493 thrombin-activated receptor signaling pathway Biological Process GO:1904707 positive regulation of vascular associated smooth muscle cell proliferation Biological Process GO:1905344 prostaglandin catabolic process Biological Process GO:1905828 regulation of prostaglandin catabolic process Biological Process GO:2001301 lipoxin biosynthetic process Biological Process
KEGG gene cross-reference	bta:532505 hsa:284273 mmu:15446 mmu:225791 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.449

Rank 1 · TkA04G424220 · TK1151

Mitochondrion0.201

Rank 2 · TkA04G424220 · TK1151

Peroxisome0.185

Rank 3 · TkA04G424220 · TK1151

Nucleus0.148

Rank 4 · TkA04G424220 · TK1151

Cell membrane0.078

Rank 5 · TkA04G424220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08240ADH_N40-121 aa

PF02254TrkA_N137-205 aa

PF00107ADH_zinc_N166-300 aa

PF13602ADH_zinc_N_2198-343 aa

PF08240ADH_N236-257 aa

PF08240ADH_N322-339 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G424220	`PF08240`	ADH_N	40	121	3e-10	41.0
TkA04G424220	`PF02254`	TrkA_N	137	205	0.21	12.6
TkA04G424220	`PF00107`	ADH_zinc_N	166	300	4.1e-22	79.2
TkA04G424220	`PF13602`	ADH_zinc_N_2	198	343	1.1e-19	72.3
TkA04G424220	`PF08240`	ADH_N	236	257	3e-10	41.0
TkA04G424220	`PF08240`	ADH_N	322	339	3e-10	41.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card