TkA04G422450 | RubberDandelionOmics

Gene overview

TkA04G422450

Reference: TK1151 Chr: Chr04 Coordinates: 106449429-106450854 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

603 bp · TkA04G422450|TK1151|cDNA

ATGCCATCTTGTTCACCTTCAAAATACATCTCAACCTTCGAAGAATATCCTCTCCATTTCCATTTGCGAATCCACAAAGACGGCCAATGTAGAAGATTCATTGGGAATGATATCATTCCTGCTGGAATTGATCCCTTAACCAATATCCATTCCAAAGATGTCGTTATTTCACATCAATCCAAAGTATTCATAAAACTTTACATTCCTAAAACCATAATCCCTAGCCGAAAACTCCCAACTCTGATTTACTATCATGGCGG...

CDS

Download CDS FASTA

603 bp · TkA04G422450|TK1151|CDS

ATGCCATCTTGTTCACCTTCAAAATACATCTCAACCTTCGAAGAATATCCTCTCCATTTCCATTTGCGAATCCACAAAGACGGCCAATGTAGAAGATTCATTGGGAATGATATCATTCCTGCTGGAATTGATCCCTTAACCAATATCCATTCCAAAGATGTCGTTATTTCACATCAATCCAAAGTATTCATAAAACTTTACATTCCTAAAACCATAATCCCTAGCCGAAAACTCCCAACTCTGATTTACTATCATGGCGG...

Protein

Download Protein FASTA

200 aa · TkA04G422450|TK1151|PROTEIN

MPSCSPSKYISTFEEYPLHFHLRIHKDGQCRRFIGNDIIPAGIDPLTNIHSKDVVISHQSKVFIKLYIPKTIIPSRKLPTLIYYHGGGFLTESAASSTYHLTLNLITMESNVIMVSVTYRLAPEYLILVAYEDSWEAIKCVANHDNGNGPDSWLNCWVFIYTCVFGGDRAGANIAHNMPIRVGLNHVINLSVHGSDVVFG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G422450`
TK1151 ID	TkA04G422450
OH-1004 ID	LXL04_038380
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	51.900
Protein coverage (%)	TK1151 81.000 / OH-1004 50.323 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G422450

Location Chr04:106449429-106450854 (+)

Description Similar to CXE2: Probable carboxylesterase 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g47480`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At2g03550`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At3g48690`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At3g48700`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release
`At1g19190`	Carboxylesterase acting on esters with varying acyl chain length.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038380 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0016829 lyase activity Molecular Function

GO:0106435 carboxylesterase activity Molecular Function

KEGG gene cross-reference

ag:BAM20978

ath:AT1G47480

ath:AT2G03550

ath:AT3G48690

ath:AT3G48700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.828

Rank 1 · TkA04G422450 · TK1151

Nucleus0.297

Rank 2 · TkA04G422450 · TK1151

Endoplasmic reticulum0.055

Rank 3 · TkA04G422450 · TK1151

Peroxisome0.040

Rank 4 · TkA04G422450 · TK1151

Mitochondrion0.036

Rank 5 · TkA04G422450 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10340Say1_Mug18058-92 aa

PF00135COesterase66-122 aa

PF20434BD-FAE66-144 aa

PF07859Abhydrolase_381-182 aa

PF27666Encapsidation_CP392-123 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G422450	`PF10340`	Say1_Mug180	58	92	0.014	15.0
TkA04G422450	`PF00135`	COesterase	66	122	2.3e-06	27.6
TkA04G422450	`PF20434`	BD-FAE	66	144	0.00012	22.4
TkA04G422450	`PF07859`	Abhydrolase_3	81	182	2e-20	74.2
TkA04G422450	`PF27666`	Encapsidation_CP3	92	123	0.069	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SX78`	Arabidopsis thaliana	sp\|Q9SX78\|CXE2_ARATH Probable carboxylesterase 2	41.900%	Swiss-Prot	Medium
`Q9ZQ91`	Arabidopsis thaliana	sp\|Q9ZQ91\|CXE7_ARATH Probable carboxylesterase 7	35.500%	Swiss-Prot	Medium
`Q9SMN0`	Arabidopsis thaliana	sp\|Q9SMN0\|CXE12_ARATH Probable carboxylesterase 12	41.400%	Swiss-Prot	Medium
`Q9SMM9`	Arabidopsis thaliana	sp\|Q9SMM9\|CXE13_ARATH Probable carboxylesterase 13	37.600%	Swiss-Prot	Medium
`Q9LMA7`	Arabidopsis thaliana	sp\|Q9LMA7\|CXE1_ARATH Probable carboxylesterase 1	39.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card