RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G420860
Reference: TK1151 Chr: Chr04 Coordinates: 106061821-106077771 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2289 bp · TkA04G420860|TK1151|cDNA

ATAACACAAAAAGAAACGGCCAAAAACTTGTGATTATAAATTACAAATCAAAAAGACAAACTTTCCTTACTTCACACTCATAAACCATGGAAACGTAAGAGAATGGAATCCATTTATATCCCCAAACCACCCACATCGCCCTCTCTACCAATCCCGCCGGAAACTCTCTAAACCCGCCGCCGACGTCATGGGAACATGCTCTTCCAAGACTCCAAGACGCAACCCATATCTGCCACGAGATATCCCGGAGCAACTGAAAA...

CDS

Download CDS FASTA

1710 bp · TkA04G420860|TK1151|CDS

ATGGGAACATGCTCTTCCAAGACTCCAAGACGCAACCCATATCTGCCACGAGATATCCCGGAGCAACTGAAAACACCGAAGAATGACGATGATACGTCCGCCGCCGGGAAAGACTCGCCGTTTTACAGTCCCAGTCCTGCGAGATTCTTCTTGGGGAATAAAAAGTCTCCGGCAAGGCAATCGAGCGGGAAGTCGACGCCGAAAAAGATGATGAAGGGACCGTTTCCGCCGCCGTCGCCGGTGAAGCATATAATGGCGGT...

Protein

Download Protein FASTA

569 aa · TkA04G420860|TK1151|PROTEIN

MGTCSSKTPRRNPYLPRDIPEQLKTPKNDDDTSAAGKDSPFYSPSPARFFLGNKKSPARQSSGKSTPKKMMKGPFPPPSPVKHIMAVLRRRRSAKEGEQEAGAGLDKRFGLSKRFKDRYEVGDEVGRGHFGHTVSATCKAGELSGQKVAVKVIPKIKMTTTIAIEDVRREVKILQALAGHPNLIHFYDAFEDDDNVYIVMELCQGGELLDRILSRGGKFTEDEAKNVMVQILNVVSFCHLQGVMHRDLKPENFLLKAKDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G420860
TK1151 IDTkA04G420860
OH-1004 IDLXL04_038375
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.400
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G420860
LocationChr04:106061821-106077771 (+)
DescriptionSimilar to CRK5: CDPK-related kinase 5
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g50530 May play a role in signal transduction pathways that involve calcium as a second messenger. No verified direct reference in this release
At1g49580 May play a role in signal transduction pathways that involve calcium as a second messenger. No verified direct reference in this release
At3g19100 May play a role in signal transduction pathways that involve calcium as a second messenger. No verified direct reference in this release
At3g56760 May play a role in signal transduction pathways that involve calcium as a second messenger. No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0366200 Possesses kinase activity in vitro. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038375 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process
GO:0035556 intracellular signal transduction Biological Process
GO:0005634 nucleus Cellular Component
GO:0005737 cytoplasm Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0016020 membrane Cellular Component
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function
GO:0004713 protein tyrosine kinase activity Molecular Function
GO:0005516 calmodulin binding Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0009931 calcium-dependent protein serine/threonine kinase activity Molecular Function
KEGG gene cross-reference
ath:AT1G49580
ath:AT3G19100
ath:AT3G50530
dosa:Os03g0366200
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.481
Rank 1 · TkA04G420860 · TK1151
Cytoplasm0.294
Rank 2 · TkA04G420860 · TK1151
Nucleus0.210
Rank 3 · TkA04G420860 · TK1151
Endoplasmic reticulum0.071
Rank 4 · TkA04G420860 · TK1151
Golgi apparatus0.070
Rank 5 · TkA04G420860 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase119-381 aa
PF07714PK_Tyr_Ser-Thr121-371 aa
PF03109ABC1140-191 aa
PF01636APH165-210 aa
PF03109ABC1197-280 aa
PF06293Kdo197-270 aa
PF13499EF-hand_7214-226 aa
PF14531Kinase-like226-331 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G420860PF00069Pkinase1193811.5e-73248.2
TkA04G420860PF07714PK_Tyr_Ser-Thr1213714.9e-32112.0
TkA04G420860PF03109ABC11401916.2e-0832.8
TkA04G420860PF01636APH1652100.006417.0
TkA04G420860PF03109ABC11972806.2e-0832.8
TkA04G420860PF06293Kdo1972709.8e-0522.6
TkA04G420860PF13499EF-hand_72142260.0514.7
TkA04G420860PF14531Kinase-like2263310.006516.5
TkA04G420860PF01636APH2422740.006417.0
TkA04G420860PF13499EF-hand_73964230.0514.7
TkA04G420860PF13499EF-hand_74294840.0514.7
TkA04G420860PF13499EF-hand_74995570.0514.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9SCS2Arabidopsis thalianasp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 564.700%Swiss-ProtHigh
Q9FX86Arabidopsis thalianasp|Q9FX86|CAMK8_ARATH CDPK-related kinase 860.400%Swiss-ProtHigh
Q9LJL9Arabidopsis thalianasp|Q9LJL9|CAMK2_ARATH CDPK-related kinase 259.900%Swiss-ProtHigh
Q9LET1Arabidopsis thalianasp|Q9LET1|CAMK7_ARATH CDPK-related kinase 742.000%Swiss-ProtMedium
Q10KY3Oryza sativa subsp. japonicasp|Q10KY3|CAMK1_ORYSJ Calcium/calmodulin-dependent serine/threonine-protein kinase 164.600%Swiss-ProtHigh

JBrowse

View in Genome Browser