LXL04_038375 | RubberDandelionOmics

Gene overview

LXL04_038375

Reference: OH-1004 Chr: Chr09 Coordinates: 38855329-38859575 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1710 bp · LXL04_038375|LXL04_038375|OH1004|cDNA

ATGGGAACATGCTCTTCCAAGACTCCAAGACGCAACCCATATCTGCCACGAGATATCCCGGAGCAACCGAAAACACCGAAGAATGACGATGATACGTCCGCCGCCGGGAAAGACTTGCCGTTTTACAGTCCCAGTCCTGCGAGATTCTTCTTGGGGAATAAAAAGTCTCCGGCAAGGCAATCGAGCGGGAAGTCGACGCCGAAAAAGATGATGAAGGGACCGTTTCCGCCGCCGTCGCCGGCGAAGCATATAATGGCGGT...

CDS

Download CDS FASTA

1710 bp · LXL04_038375|LXL04_038375|OH1004|CDS

ATGGGAACATGCTCTTCCAAGACTCCAAGACGCAACCCATATCTGCCACGAGATATCCCGGAGCAACCGAAAACACCGAAGAATGACGATGATACGTCCGCCGCCGGGAAAGACTTGCCGTTTTACAGTCCCAGTCCTGCGAGATTCTTCTTGGGGAATAAAAAGTCTCCGGCAAGGCAATCGAGCGGGAAGTCGACGCCGAAAAAGATGATGAAGGGACCGTTTCCGCCGCCGTCGCCGGCGAAGCATATAATGGCGGT...

Protein

Download Protein FASTA

569 aa · LXL04_038375|LXL04_038375|OH1004|PROTEIN

MGTCSSKTPRRNPYLPRDIPEQPKTPKNDDDTSAAGKDLPFYSPSPARFFLGNKKSPARQSSGKSTPKKMMKGPFPPPSPAKHIMAVLRRRRSAKEGEPEAGAGLDKRFGLSKRFKDRYEVGDEVGRGHFGHTVSATCKAGELSGQKVAVKVIPKIKMTTAIAIEDVRREVKILQALAGHPNLIHFYDAFEDDDNVYIVMELCQGGELLDRILSRGGKFTEDEAKNVMVQILNVVSFCHLQGVMHRDLKPENFLLKAKDD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038375`
TK1151 ID	TkA04G420860
OH-1004 ID	LXL04_038375
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038375

Location Chr09:38855329-38859575 (+)

Description Similar to CRK5: CDPK-related kinase 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g50530`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At3g19100`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release
`At1g49580`	May play a role in signal transduction pathways that involve calcium as a second messenger.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0366200`	Possesses kinase activity in vitro.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038375 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009939 positive regulation of gibberellic acid mediated signaling pathway Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004683 calcium/calmodulin-dependent protein kinase activity Molecular Function

GO:0004713 protein tyrosine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0009931 calcium-dependent protein serine/threonine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G49580

ath:AT3G19100

ath:AT3G50530

dosa:Os03g0366200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.501

Rank 1 · LXL04_038375 · OH-1004

Cytoplasm0.276

Rank 2 · LXL04_038375 · OH-1004

Nucleus0.199

Rank 3 · LXL04_038375 · OH-1004

Endoplasmic reticulum0.072

Rank 4 · LXL04_038375 · OH-1004

Golgi apparatus0.068

Rank 5 · LXL04_038375 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069.32Pkinase119-381 aa

PF07714.24PK_Tyr_Ser-Thr121-337 aa

PF03109.23ABC1197-280 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038375	`PF00069.32`	Pkinase	119	381	5.4e-74	249.6
LXL04_038375	`PF07714.24`	PK_Tyr_Ser-Thr	121	337	1.2e-31	110.7
LXL04_038375	`PF03109.23`	ABC1	197	280	7.6e-08	32.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCS2`	Arabidopsis thaliana	CDPK-related kinase 5	65.050%	Swiss-Prot	strong database homology
`Q9LJL9`	Arabidopsis thaliana	CDPK-related kinase 2	61.603%	Swiss-Prot	strong database homology
`Q9FX86`	Arabidopsis thaliana	CDPK-related kinase 8	60.626%	Swiss-Prot	strong database homology
`Q10KY3`	Oryza sativa subsp. japonica	Calcium/calmodulin-dependent serine/threonine-protein kinase 1	65.065%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card