TkA04G420850 | RubberDandelionOmics

Gene overview

TkA04G420850

Reference: TK1151 Chr: Chr04 Coordinates: 106058683-106059571 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

450 bp · TkA04G420850|TK1151|cDNA

ATGTTTTTTTTGTTTTTGCCCCTACACTTTATTTGGACCTTAACCTGTTTTTGTGGGATTCTGACTTCCAAAAATATAATACTAAGTAATATTCATATTTTATGTTTTATTCTTTGTGTATTTATGCAGACCCGTTTATGGCAACGAGATATGCGGGATAGGACAATATTACAACCGACCCCTGCTGCAGCAATCGATATGTTACCAACAGTTGCCTATTCAGATAATCCATCAACCAGCTTTGCATCCAAATTTGTTCA...

CDS

Download CDS FASTA

450 bp · TkA04G420850|TK1151|CDS

ATGTTTTTTTTGTTTTTGCCCCTACACTTTATTTGGACCTTAACCTGTTTTTGTGGGATTCTGACTTCCAAAAATATAATACTAAGTAATATTCATATTTTATGTTTTATTCTTTGTGTATTTATGCAGACCCGTTTATGGCAACGAGATATGCGGGATAGGACAATATTACAACCGACCCCTGCTGCAGCAATCGATATGTTACCAACAGTTGCCTATTCAGATAATCCATCAACCAGCTTTGCATCCAAATTTGTTCA...

Protein

Download Protein FASTA

149 aa · TkA04G420850|TK1151|PROTEIN

MFFLFLPLHFIWTLTCFCGILTSKNIILSNIHILCFILCVFMQTRLWQRDMRDRTILQPTPAAAIDMLPTVAYSDNPSTSFASKFVHTSLNKNRCSINRVLWTPTGRRLITGSHSGEFTLWNGQSFTFEMILQAHDQPIRSMVWSYNGN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G420850`
TK1151 ID	TkA04G420850
OH-1004 ID	LXL04_034316
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.100
Protein coverage (%)	TK1151 68.456 / OH-1004 14.468 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G420850

Location Chr04:106058683-106059571 (+)

Description Similar to FY: Flowering time control protein FY

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13480`	Plays a role in the regulation of flowering time in the autonomous flowering pathway by decreasing FLOWERING LOCUS C mRNA levels.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034316 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006301 DNA damage tolerance Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031124 mRNA 3'-end processing Biological Process

GO:0001650 fibrillar center Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005847 mRNA cleavage and polyadenylation specificity factor complex Cellular Component

KEGG gene cross-reference

ath:AT5G13480

cel:CELE_R06A4.9

hsa:55339

mmu:74320

ncr:NCU00037

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.384

Rank 1 · TkA04G420850 · TK1151

Nucleus0.375

Rank 2 · TkA04G420850 · TK1151

Mitochondrion0.150

Rank 3 · TkA04G420850 · TK1151

Peroxisome0.072

Rank 4 · TkA04G420850 · TK1151

Golgi apparatus0.034

Rank 5 · TkA04G420850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24782WD40_MABP1-WDR62_2nd12-144 aa

PF23756Beta-prop_HPS532-51 aa

PF23756Beta-prop_HPS580-138 aa

PF29037DSE1_N82-147 aa

PF24814WD40_Prp1984-142 aa

PF24805EIF3I86-145 aa

PF25172Beta-prop_WDR3_2nd87-148 aa

PF24807WD40_CDC20-Fz88-146 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G420850	`PF24782`	WD40_MABP1-WDR62_2nd	12	144	0.052	13.2
TkA04G420850	`PF23756`	Beta-prop_HPS5	32	51	0.093	12.7
TkA04G420850	`PF23756`	Beta-prop_HPS5	80	138	0.093	12.7
TkA04G420850	`PF29037`	DSE1_N	82	147	0.11	12.2
TkA04G420850	`PF24814`	WD40_Prp19	84	142	0.00018	21.4
TkA04G420850	`PF24805`	EIF3I	86	145	0.057	13.3
TkA04G420850	`PF25172`	Beta-prop_WDR3_2nd	87	148	0.016	15.1
TkA04G420850	`PF24807`	WD40_CDC20-Fz	88	146	0.00034	20.7
TkA04G420850	`PF24797`	Beta-prop_WDR35_TULP_N	88	148	0.048	13.5
TkA04G420850	`PF23383`	Beta-prop_IFT140_1st	89	149	2.5e-05	23.9
TkA04G420850	`PF25174`	Beta-prop_THOC3	89	148	6.8e-05	22.7
TkA04G420850	`PF24817`	WD40_WDHD1_1st	89	147	0.00021	21.3
TkA04G420850	`PF25173`	Beta-prop_WDR3_1st	89	147	0.00067	20.1
TkA04G420850	`PF23414`	Beta-prop_EML_2	89	148	0.0038	17.3
TkA04G420850	`PF00400`	WD40	90	122	3.5e-06	28.0
TkA04G420850	`PF12894`	ANAPC4_WD40	90	147	0.0077	17.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NLV4`	Arabidopsis thaliana	sp\|Q6NLV4\|FY_ARATH Flowering time control protein FY	88.200%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card