LXL04_034316 | RubberDandelionOmics

Gene overview

LXL04_034316

Reference: OH-1004 Chr: Chr07 Coordinates: 96286748-96293630 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2118 bp · LXL04_034316|LXL04_034316|OH1004|cDNA

ATGATGTACAATGATCCTCAGCAACAACAGCAGCAGCAACAACCACCACCAATGTATCAGCAACACCCTCCACCACCGCCGCCTCAACAGCAAATGATGCAGCAGCACCCACATCACCAGCACCACCTCCAACAGCCGCCGCCACATCAATTTCACCAGCCGCAGCAAATGGGAGAGTTTCAGAGGGGTCCGCCGCAACAGCAGCATCAGCaaccgccaccgccaccgcaGATGATGCGTCAGACTTCTGCTTCTTCCAC...

CDS

Download CDS FASTA

2118 bp · LXL04_034316|LXL04_034316|OH1004|CDS

ATGATGTACAATGATCCTCAGCAACAACAGCAGCAGCAACAACCACCACCAATGTATCAGCAACACCCTCCACCACCGCCGCCTCAACAGCAAATGATGCAGCAGCACCCACATCACCAGCACCACCTCCAACAGCCGCCGCCACATCAATTTCACCAGCCGCAGCAAATGGGAGAGTTTCAGAGGGGTCCGCCGCAACAGCAGCATCAGCAACCGCCACCGCCACCGCAGATGATGCGTCAGACTTCTGCTTCTTCCAC...

Protein

Download Protein FASTA

705 aa · LXL04_034316|LXL04_034316|OH1004|PROTEIN

MMYNDPQQQQQQQQPPPMYQQHPPPPPPQQQMMQQHPHHQHHLQQPPPHQFHQPQQMGEFQRGPPQQQHQQPPPPPQMMRQTSASSTTLGGPQEYHQQLNHPPFDDNFAAKRMRKIGQRRAVDYTSTVVRYMQTRLWQRDTRDRTILQPTPAAAIDMLPTVAYSDNPSTSFASKFVHTSLNKNRCSINRVLWTPTGRRLITGSHSGEFTLWNGQSFNFEMILQAHDQPIRSMVWSYNDNWMVTGDDGGSIKYWQNNMNNV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_034316`
TK1151 ID	TkA04G420850
OH-1004 ID	LXL04_034316
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	97.100
Protein coverage (%)	TK1151 68.456 / OH-1004 14.468 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_034316

Location Chr07:96286748-96293630 (-)

Description Similar to FY: Flowering time control protein FY

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13480`	Plays a role in the regulation of flowering time in the autonomous flowering pathway by decreasing FLOWERING LOCUS C mRNA levels.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_034316 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006301 DNA damage tolerance Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007283 spermatogenesis Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0030154 cell differentiation Biological Process

GO:0031124 mRNA 3'-end processing Biological Process

GO:0001650 fibrillar center Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005847 mRNA cleavage and polyadenylation specificity factor complex Cellular Component

KEGG gene cross-reference

ath:AT5G13480

cel:CELE_R06A4.9

hsa:55339

mmu:74320

ncr:NCU00037

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.887

Rank 1 · LXL04_034316 · OH-1004

Cytoplasm0.249

Rank 2 · LXL04_034316 · OH-1004

Cell membrane0.027

Rank 3 · LXL04_034316 · OH-1004

Mitochondrion0.014

Rank 4 · LXL04_034316 · OH-1004

Endoplasmic reticulum0.013

Rank 5 · LXL04_034316 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24782.3WD40_MABP1-WDR62_2nd135-422 aa

PF30552.1CFAP251_N170-289 aa

PF25173.2Beta-prop_WDR3_1st172-254 aa

PF29037.1DSE1_N172-258 aa

PF25168.2Beta-prop_WDR36-Utp21_2nd174-343 aa

PF25174.2Beta-prop_THOC3177-358 aa

PF25172.2Beta-prop_WDR3_2nd177-256 aa

PF24807.2WD40_CDC20-Fz178-348 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_034316	`PF24782.3`	WD40_MABP1-WDR62_2nd	135	422	1.8e-13	50.9
LXL04_034316	`PF30552.1`	CFAP251_N	170	289	7.6e-10	39.2
LXL04_034316	`PF25173.2`	Beta-prop_WDR3_1st	172	254	1.3e-47	162.6
LXL04_034316	`PF29037.1`	DSE1_N	172	258	1.1e-18	68.2
LXL04_034316	`PF25168.2`	Beta-prop_WDR36-Utp21_2nd	174	343	1.1e-24	88.1
LXL04_034316	`PF25174.2`	Beta-prop_THOC3	177	358	5.9e-68	229.5
LXL04_034316	`PF25172.2`	Beta-prop_WDR3_2nd	177	256	1.6e-28	100.5
LXL04_034316	`PF24807.2`	WD40_CDC20-Fz	178	348	8.2e-44	150.8
LXL04_034316	`PF24817.2`	WD40_WDHD1_1st	179	250	1.5e-29	103.8
LXL04_034316	`PF23414.2`	Beta-prop_EML_2	179	264	8e-27	95.0
LXL04_034316	`PF23383.2`	Beta-prop_IFT140_1st	180	268	2.2e-20	73.5
LXL04_034316	`PF23609.2`	Beta-prop_EIPR1	180	337	1.4e-13	51.6
LXL04_034316	`PF25175.2`	Beta-prop_WDR5	181	258	1.8e-47	162.7
LXL04_034316	`PF23381.2`	Beta-prop_IFT122_1st	184	296	3.4e-41	142.1
LXL04_034316	`PF24796.2`	WDR55	185	296	1e-32	114.1
LXL04_034316	`PF25391.2`	WD40_Gbeta	185	390	9.1e-26	91.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6NLV4`	Arabidopsis thaliana	Flowering time control protein FY	67.615%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card