TkA04G419430 | RubberDandelionOmics

Gene overview

TkA04G419430

Reference: TK1151 Chr: Chr04 Coordinates: 105652530-105653132 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

603 bp · TkA04G419430|TK1151|cDNA

ATGTTGGATCTTAATCTGGATGTAGTAGTGCCTGTTGATGATTCTGGTTATAAACGCGATCGGATTGAATTTGAGACCGAGAATAATGTTTTGGAAGATCGTCAGTCGGAGATTTATTCCGGTACTTCAGTTTCATCTGACGTTTTGAACGCCGATGACGATCCTCCTGTCACCAATGCTGCCGACGCTGATGACGAAGGCTCGGTATCCTGTACTGCTAGTAATATCGACAAGCTCTCTTATCATTTCGGTTTCGCCGA...

CDS

Download CDS FASTA

603 bp · TkA04G419430|TK1151|CDS

ATGTTGGATCTTAATCTGGATGTAGTAGTGCCTGTTGATGATTCTGGTTATAAACGCGATCGGATTGAATTTGAGACCGAGAATAATGTTTTGGAAGATCGTCAGTCGGAGATTTATTCCGGTACTTCAGTTTCATCTGACGTTTTGAACGCCGATGACGATCCTCCTGTCACCAATGCTGCCGACGCTGATGACGAAGGCTCGGTATCCTGTACTGCTAGTAATATCGACAAGCTCTCTTATCATTTCGGTTTCGCCGA...

Protein

Download Protein FASTA

200 aa · TkA04G419430|TK1151|PROTEIN

MLDLNLDVVVPVDDSGYKRDRIEFETENNVLEDRQSEIYSGTSVSSDVLNADDDPPVTNAADADDEGSVSCTASNIDKLSYHFGFADRSGKVKELSNGVSGRIITRQFFPVDGDLELEDEELVSHSVTSSPLTISSLESHWLNLKVPEPAQAPRNLQVLPPSQQAKKSRRGPRSRSSQYRGVTFYRRTLLNSGGERDEVY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G419430`
TK1151 ID	TkA04G419430
OH-1004 ID	LXL04_038346
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	87.000
Protein coverage (%)	TK1151 100.000 / OH-1004 57.190 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G419430

Location Chr04:105652530-105653132 (-)

Description Similar to TOE2: AP2-like ethylene-responsive transcription factor TOE2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28550`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At3g54990`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At5g60120`	Probably acts as a transcriptional activator.	No verified direct reference in this release
`At4g36920`	Probable transcriptional activator that promotes early floral meristem identity.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0235800`	Probable transcription factor (By similarity).	OsMADS1 Represses microRNA172 in Elongation of Palea/Lemma Development in Rice.2016 · DOI: 10.3389/fpls.2016.01891

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038346 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0045824 negative regulation of innate immune response Biological Process

GO:0080050 regulation of seed development Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001222 transcription corepressor binding Molecular Function

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G60120

osa:4334582

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.552

Rank 1 · TkA04G419430 · TK1151

Cytoplasm0.388

Rank 2 · TkA04G419430 · TK1151

Cell membrane0.085

Rank 3 · TkA04G419430 · TK1151

Mitochondrion0.048

Rank 4 · TkA04G419430 · TK1151

Endoplasmic reticulum0.048

Rank 5 · TkA04G419430 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SK03`	Arabidopsis thaliana	sp\|Q9SK03\|RAP27_ARATH Ethylene-responsive transcription factor RAP2-7	37.600%	Swiss-Prot	Medium
`Q6PV68`	Arabidopsis thaliana	sp\|Q6PV68\|SMZ_ARATH AP2-like ethylene-responsive transcription factor SMZ	62.700%	Swiss-Prot	Low
`Q9LVG2`	Arabidopsis thaliana	sp\|Q9LVG2\|TOE2_ARATH AP2-like ethylene-responsive transcription factor TOE2	83.900%	Swiss-Prot	Low
`P47927`	Arabidopsis thaliana	sp\|P47927\|AP2_ARATH Floral homeotic protein APETALA 2	83.900%	Swiss-Prot	Low
`Q8H443`	Oryza sativa subsp. japonica	sp\|Q8H443\|AP23_ORYSJ APETALA2-like protein 3	38.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card