TkA04G414780 | RubberDandelionOmics

Gene overview

TkA04G414780

Reference: TK1151 Chr: Chr04 Coordinates: 104453108-104454572 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1311 bp · TkA04G414780|TK1151|cDNA

AAAGAGGAAAGATAATATAGTAATAAATAATAGCCTGAATGCTTAAAAGTCAAAAGGTCTGTTGGTCGTCATACTTAAATTAACAGTTATTGCCAACGAAAAAAAAAGGAAAGATAATATACTAATAAATAATAATAATGAAATTGACACATTGATCCCTAAATAGTAAAAGCCAGCGTATCTATAACCTCCACACTTGGCCATTTTCATCTGAAAACTCAGCCATGGCTTCTTCTCCTTCCAGTTGCAGCCTTCTCTTT...

CDS

Download CDS FASTA

834 bp · TkA04G414780|TK1151|CDS

ATGGCTTCTTCTCCTTCCAGTTGCAGCCTTCTCTTTCATCTTCTACTGCTGATACAGTTTTGCAGTTCTCGAGAAATCATCGACAAAACCCCGAAGAAAAACGACGAAAATCATATAACAATTTACGGGAAAAACAAAGTCCAAGATTTTGATCCTGCTTTAAAAGTGTTCTTCCATGTAACCGATTTACACATCGGCAAAAAAATGCCGATTTATTTCGCGAAAAACGATCCTTCAACAACTCCTCGTTTACTCACTAA...

Protein

Download Protein FASTA

277 aa · TkA04G414780|TK1151|PROTEIN

MASSPSSCSLLFHLLLLIQFCSSREIIDKTPKKNDENHITIYGKNKVQDFDPALKVFFHVTDLHIGKKMPIYFAKNDPSTTPRLLTKEQSDSIPFSSSKLPYLLDLLSLTKDSPQAKAMDQTLKQCELEPTPGETRFCATSLESMLDLTREVLGMVKLKVLTTNIHNLTESGYTLLQGYTFLKEPSEIQVPDMVACHTMAYPYAVYYCHAQKGYNRAFKISLGGENGNRIDAIAVCHMDTSKWDRDHVAFRVLGVQPGTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G414780`
TK1151 ID	TkA04G414780
OH-1004 ID	LXL04_038289
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G414780

Location Chr04:104453108-104454572 (+)

Description Similar to USPL1: BURP domain protein USPL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49320`	Associated with the protein storage vacuole formation.	The BURP domain protein AtUSPL1 of Arabidopsis thaliana is destined to the protein storage vacuoles and overexpression of the cognate gene distorts seed development.2009 · DOI: 10.1007/s11103-009-9526-6

Rice

Reference gene ID	Possible function	Papers / DOI
`Os11g0170900`	BURP domain-containing protein 17.	No verified direct reference in this release
`Os04g0225700`	BURP domain-containing protein 5.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038289 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0048316 seed development Biological Process

GO:0000326 protein storage vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005795 Golgi stack Cellular Component

KEGG gene cross-reference

ath:AT1G49320

bna:106419576

bna:106439079

dosa:Os01g0733500

dosa:Os11g0170900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.356

Rank 1 · TkA04G414780 · TK1151

Extracellular0.323

Rank 2 · TkA04G414780 · TK1151

Endoplasmic reticulum0.165

Rank 3 · TkA04G414780 · TK1151

Cytoplasm0.145

Rank 4 · TkA04G414780 · TK1151

Cell membrane0.096

Rank 5 · TkA04G414780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03181BURP56-274 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G414780	`PF03181`	BURP	56	274	5.4e-78	262.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XI99`	Arabidopsis thaliana	sp\|Q9XI99\|USPL1_ARATH BURP domain protein USPL1	45.100%	Swiss-Prot	Medium
`B9G9L9`	Oryza sativa subsp. japonica	sp\|B9G9L9\|BURPH_ORYSJ BURP domain-containing protein 17	40.000%	Swiss-Prot	Medium
`Q0JEP3`	Oryza sativa subsp. japonica	sp\|Q0JEP3\|BURP5_ORYSJ BURP domain-containing protein 5	38.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card