LXL04_038289 | RubberDandelionOmics

Gene overview

LXL04_038289

Reference: OH-1004 Chr: Chr09 Coordinates: 36669804-36670766 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

810 bp · LXL04_038289|LXL04_038289|OH1004|cDNA

ATGGCTTCTTCTCCTTCCAGTTGCAGCCTTCTCTTTCATCTTCTACTGCTGATACAGTTTTGCAGTTCTCGAGAAAACGACGAAAATCATATAACAATTTACGGGAAAAACAAAGTCCAAGATTTTGATCCTGCTTTAAAAGTGTTCTTCCATGTAACCGATTTACACATCGGCAAAAAAATGCCGATTTATTTCGCGAAAAACGATCCTTCAACAACTCCTCGTTTACTCACTAAAGAACAATCTGATTCAATACCATT...

CDS

Download CDS FASTA

810 bp · LXL04_038289|LXL04_038289|OH1004|CDS

ATGGCTTCTTCTCCTTCCAGTTGCAGCCTTCTCTTTCATCTTCTACTGCTGATACAGTTTTGCAGTTCTCGAGAAAACGACGAAAATCATATAACAATTTACGGGAAAAACAAAGTCCAAGATTTTGATCCTGCTTTAAAAGTGTTCTTCCATGTAACCGATTTACACATCGGCAAAAAAATGCCGATTTATTTCGCGAAAAACGATCCTTCAACAACTCCTCGTTTACTCACTAAAGAACAATCTGATTCAATACCATT...

Protein

Download Protein FASTA

269 aa · LXL04_038289|LXL04_038289|OH1004|PROTEIN

MASSPSSCSLLFHLLLLIQFCSSRENDENHITIYGKNKVQDFDPALKVFFHVTDLHIGKKMPIYFAKNDPSTTPRLLTKEQSDSIPFSSSKLPYLLDLLSLTKDSPQAKAMDQTLKQCELEPTPGETRFCATSLESMLDLTREVLGMVKLKVLTTNIHNLTESGYTLLQGYTFLKEPSEIQVPDMVACHTMAYPYAVYYCHAQKGYNRAFKISLGGENGNRIDAIAVCHMDTSKWDRDHVAFRVLGVQPGTSPVCHFLPA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038289`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038289

Location Chr09:36669804-36670766 (+)

Description Similar to USPL1: BURP domain protein USPL1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g49320`	Associated with the protein storage vacuole formation.	The BURP domain protein AtUSPL1 of Arabidopsis thaliana is destined to the protein storage vacuoles and overexpression of the cognate gene distorts seed development.2009 · DOI: 10.1007/s11103-009-9526-6

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0733500`	BURP domain-containing protein 3.	No verified direct reference in this release
`Os11g0170900`	BURP domain-containing protein 17.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038289 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0048316 seed development Biological Process

GO:0000326 protein storage vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005795 Golgi stack Cellular Component

KEGG gene cross-reference

ath:AT1G49320

bna:106419576

bna:106439079

dosa:Os01g0733500

dosa:Os11g0170900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.406

Rank 1 · LXL04_038289 · OH-1004

Extracellular0.291

Rank 2 · LXL04_038289 · OH-1004

Endoplasmic reticulum0.164

Rank 3 · LXL04_038289 · OH-1004

Cytoplasm0.148

Rank 4 · LXL04_038289 · OH-1004

Golgi apparatus0.095

Rank 5 · LXL04_038289 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03181.21BURP48-266 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038289	`PF03181.21`	BURP	48	266	4.9e-78	262.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9XI99`	Arabidopsis thaliana	BURP domain protein USPL1	47.012%	Swiss-Prot	moderate database homology
`Q942D4`	Oryza sativa subsp. japonica	BURP domain-containing protein 3	40.708%	Swiss-Prot	moderate database homology
`B9G9L9`	Oryza sativa subsp. japonica	BURP domain-containing protein 17	40.000%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card