TkA04G393650 | RubberDandelionOmics

Gene overview

TkA04G393650

Reference: TK1151 Chr: Chr04 Coordinates: 99012938-99015041 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

420 bp · TkA04G393650|TK1151|cDNA

ATGAATGATTCATGTCGTCTGGAAGAACCCAAACTCCTTTCGCAGCCACCATCTCCCTTCGTCGCCACCATCGTACCACCACCCTATCGCACCATCCATCTCACCACTGTTTGGAATGAATGGATTCATTACCTTCAAACACTTGGAAACCTACAGTTTTTTATTGGAGGCGTCGGCGTCTACATGCTTCACACGACTCCTGTTTCACCATCCTCGGACACCACCAATACTATATACAGAAATCAGTTCATTGCAGGATC...

CDS

Download CDS FASTA

420 bp · TkA04G393650|TK1151|CDS

ATGAATGATTCATGTCGTCTGGAAGAACCCAAACTCCTTTCGCAGCCACCATCTCCCTTCGTCGCCACCATCGTACCACCACCCTATCGCACCATCCATCTCACCACTGTTTGGAATGAATGGATTCATTACCTTCAAACACTTGGAAACCTACAGTTTTTTATTGGAGGCGTCGGCGTCTACATGCTTCACACGACTCCTGTTTCACCATCCTCGGACACCACCAATACTATATACAGAAATCAGTTCATTGCAGGATC...

Protein

Download Protein FASTA

139 aa · TkA04G393650|TK1151|PROTEIN

MNDSCRLEEPKLLSQPPSPFVATIVPPPYRTIHLTTVWNEWIHYLQTLGNLQFFIGGVGVYMLHTTPVSPSSDTTNTIYRNQFIAGSILKVKPGGGGLNAAIFEVAGPDLDSATKKQARFLTQGKAITIPLPSTSPLLT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G393650`
TK1151 ID	TkA04G393650
OH-1004 ID	LXL04_024153
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	67.100
Protein coverage (%)	TK1151 59.712 / OH-1004 40.909 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G393650

Location Chr04:99012938-99015041 (-)

Description Similar to BHLH140: Transcription factor bHLH140

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01310`	Transcription factor bHLH140.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024153 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000012 single strand break repair Biological Process

GO:0006260 DNA replication Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006790 sulfur compound metabolic process Biological Process

GO:0009150 purine ribonucleotide metabolic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0003697 single-stranded DNA binding Molecular Function

GO:0003725 double-stranded RNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0030983 mismatched DNA binding Molecular Function

GO:0033699 DNA 5'-adenosine monophosphate hydrolase activity Molecular Function

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.414

Rank 1 · TkA04G393650 · TK1151

Nucleus0.406

Rank 2 · TkA04G393650 · TK1151

Mitochondrion0.137

Rank 3 · TkA04G393650 · TK1151

Cell membrane0.084

Rank 4 · TkA04G393650 · TK1151

Endoplasmic reticulum0.073

Rank 5 · TkA04G393650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M041`	Arabidopsis thaliana	sp\|Q9M041\|BH140_ARATH Transcription factor bHLH140	62.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card