TkA04G390680 | RubberDandelionOmics

Gene overview

TkA04G390680

Reference: TK1151 Chr: Chr04 Coordinates: 98247934-98252291 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1563 bp · TkA04G390680|TK1151|cDNA

ATGGATGGGGTGAGAGTAGATGAGGGTTGTGGGTCTAAGGGTGGTGAGGGTAGGGATGGGTTAGTTGGATCAGGGGTGATGGGGCATGATCAGATTGGGGTGGGTCTGTTGGTGGCAGGATGGAGTTGGGGTAGTAGGGGAAGACGACGGCCGGAGAAGACGACCGACATCGCAGCAGCTCCGCACTTCATTTTTTCGCCTGGTCTTCGAGTTTTCAGCGTGTTCGGGAAGGAGCAGCGCACGAGAGAGCTCGAGGCAGG...

CDS

Download CDS FASTA

1563 bp · TkA04G390680|TK1151|CDS

ATGGATGGGGTGAGAGTAGATGAGGGTTGTGGGTCTAAGGGTGGTGAGGGTAGGGATGGGTTAGTTGGATCAGGGGTGATGGGGCATGATCAGATTGGGGTGGGTCTGTTGGTGGCAGGATGGAGTTGGGGTAGTAGGGGAAGACGACGGCCGGAGAAGACGACCGACATCGCAGCAGCTCCGCACTTCATTTTTTCGCCTGGTCTTCGAGTTTTCAGCGTGTTCGGGAAGGAGCAGCGCACGAGAGAGCTCGAGGCAGG...

Protein

Download Protein FASTA

520 aa · TkA04G390680|TK1151|PROTEIN

MDGVRVDEGCGSKGGEGRDGLVGSGVMGHDQIGVGLLVAGWSWGSRGRRRPEKTTDIAAAPHFIFSPGLRVFSVFGKEQRTRELEAGLFTCVGARSRRTTRERVLRLLVRENSCGSALMGHPVSCVETQTAVRIVGRSDLDDLGWTSGQAWIGVEVSRRAPTNENTGSTMTRSGMTSDQVRDLVAEEVTGAIGDVIPGIVTVIREQLVATMEERISAIPVAGVQHPRPKEFQYREFAACFPPEFRGETDPVVSMRWISDM...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G390680`
TK1151 ID	TkA04G390680
OH-1004 ID	LXL04_022027
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	55.200
Protein coverage (%)	TK1151 52.308 / OH-1004 94.430 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G390680`
Location	Chr04:98247934-98252291 (+)
Description	Similar to gag-pol: Gag-Pol polyprotein (Human immunodeficiency virus type 1 group O (isolate MVP5180)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022027` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006310 DNA recombination Biological Process GO:0006508 proteolysis Biological Process GO:0015074 DNA integration Biological Process GO:0039657 symbiont-mediated suppression of host gene expression Biological Process GO:0039702 viral budding via host ESCRT complex Biological Process GO:0044826 viral genome integration into host DNA Biological Process GO:0046718 symbiont entry into host cell Biological Process GO:0052151 symbiont-mediated activation of host apoptosis Biological Process GO:0075523 viral translational frameshifting Biological Process GO:0075713 establishment of integrated proviral latency Biological Process GO:0075732 viral penetration into host nucleus Biological Process GO:2000767 positive regulation of cytoplasmic translation Biological Process
KEGG gene cross-reference	sce:YNL255C These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.512

Rank 1 · TkA04G390680 · TK1151

Nucleus0.392

Rank 2 · TkA04G390680 · TK1151

Mitochondrion0.089

Rank 3 · TkA04G390680 · TK1151

Cell membrane0.079

Rank 4 · TkA04G390680 · TK1151

Endoplasmic reticulum0.061

Rank 5 · TkA04G390680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03732PEG10_N-capsid241-319 aa

PF19259Ty3_capsid243-396 aa

PF21934Yop-YscD_ppl_3rd293-325 aa

PF08284RVP_2439-520 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G390680	`PF03732`	PEG10_N-capsid	241	319	4e-11	43.8
TkA04G390680	`PF19259`	Ty3_capsid	243	396	0.00031	20.9
TkA04G390680	`PF21934`	Yop-YscD_ppl_3rd	293	325	0.093	13.2
TkA04G390680	`PF08284`	RVP_2	439	520	3.6e-12	47.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card