TkA04G390040 | RubberDandelionOmics

Gene overview

TkA04G390040

Reference: TK1151 Chr: Chr04 Coordinates: 98112781-98118162 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1967 bp · TkA04G390040|TK1151|cDNA

CTGTAACGTTATTTAAATTCATCTTTATGTATCCCATGGAATTTTTGATCTTCTTTGCCACTTTATAACATGAACACAACCACACAGAGTCTTAGATTCTCTCATTTCTTCGCTCCTAAAATCTCTTTTTTTAGGAGGGAGGGAATCCCATAAAATACTGATTTAATTATTAATTTGAATTACGATTGGAATCCCAAAAATGAAGAAGACGAAGCGGCCATTATCATTTTTACGCCATTGCTGCTTCCTTCTCTCCGTCT...

CDS

Download CDS FASTA

1260 bp · TkA04G390040|TK1151|CDS

ATGGCATTCACCGTCACAATGCTGTCGTGGAGTATCATCGAGTACGGAGAGTACATTGCCGGTGCCGGTGAGCTAGAGCACGCCATGGAGGCGATTAAATGGGGAACCGATTATTTTATCAAAGCTCACACTAGCCCTAACGTGTTATGGGCTGAGGTCGGTGACGGAGACACCGATCACTACTGCTGGCAACGGCCGGAGGACATGACGACATCGAGACAAGCATACAAGATCGATGAGAACAATCCGGGGTCAGATCT...

Protein

Download Protein FASTA

419 aa · TkA04G390040|TK1151|PROTEIN

MAFTVTMLSWSIIEYGEYIAGAGELEHAMEAIKWGTDYFIKAHTSPNVLWAEVGDGDTDHYCWQRPEDMTTSRQAYKIDENNPGSDLAGETAAAMAAASIVLKKTNPHYSHMLLHHAQQLFEFGDKYRGKYDESIGVVKNYYTSVSGHEDELLWAAMWLYKATDNRRYLNYVIENADSFGGVGWSITEFSWDVKFAGIQVLASQLLTEEKHTKYNDILQKYKSKAKYYICSCLNKNNGTKNNVKFTPGGLLYIRQWNNMQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G390040`
TK1151 ID	TkA04G390040
OH-1004 ID	LXL04_038112
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.100
Protein coverage (%)	TK1151 98.807 / OH-1004 27.989 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G390040

Location Chr04:98112781-98118162 (+)

Description Similar to At2g32990: Endoglucanase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32990`	Endoglucanase 11.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0738600`	Endoglucanase 7.	No verified direct reference in this release
`Os09g0394300`	Endoglucanase 22.	No verified direct reference in this release
`Os06g0247900`	Endoglucanase 16.	No verified direct reference in this release
`Os02g0151300`	Endoglucanase 5.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038112 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0030245 cellulose catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0008810 cellulase activity Molecular Function

KEGG gene cross-reference

ath:AT2G32990

dosa:Os02g0151300

dosa:Os02g0738600

dosa:Os06g0247900

dosa:Os09g0394300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.366

Rank 1 · TkA04G390040 · TK1151

Extracellular0.282

Rank 2 · TkA04G390040 · TK1151

Lysosome / Vacuole0.208

Rank 3 · TkA04G390040 · TK1151

Cytoplasm0.149

Rank 4 · TkA04G390040 · TK1151

Endoplasmic reticulum0.097

Rank 5 · TkA04G390040 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00759Glyco_hydro_91-403 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G390040	`PF00759`	Glyco_hydro_9	1	403	5.8e-135	451.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48766`	Arabidopsis thaliana	sp\|O48766\|GUN11_ARATH Endoglucanase 11	73.300%	Swiss-Prot	High
`Q6Z5P2`	Oryza sativa subsp. japonica	sp\|Q6Z5P2\|GUN7_ORYSJ Endoglucanase 7	65.000%	Swiss-Prot	High
`Q6H3Z9`	Oryza sativa subsp. japonica	sp\|Q6H3Z9\|GUN22_ORYSJ Endoglucanase 22	61.900%	Swiss-Prot	High
`Q654U4`	Oryza sativa subsp. japonica	sp\|Q654U4\|GUN16_ORYSJ Endoglucanase 16	62.900%	Swiss-Prot	High
`Q67UW5`	Oryza sativa subsp. japonica	sp\|Q67UW5\|GUN5_ORYSJ Endoglucanase 5	62.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card