LXL04_038112 | RubberDandelionOmics

Gene overview

LXL04_038112

Reference: OH-1004 Chr: Chr09 Coordinates: 31586736-31597225 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4419 bp · LXL04_038112|LXL04_038112|OH1004|cDNA

ATGAAGAAGACGAAGCGGCCATTATCATTTTTACGCCATTGCTGCTTCCTTCTCTCCGTCTTCTCCATTTTTACCTCTTGCAGATCTAGTCCTTCACATAATTATGCCGACGCTCTCACTAAATCTCTGCTATACTTCGAAGCCCAGCGCTCCGGCCGCCTTCCGTACAACCAACGTGTCACATGGCGCGACAATTCCGGCCTCACCGACGGCCTTGAACAAGGCGTGGACTTGGTCGGAGGTTATTACGACGCCGGAGA...

CDS

Download CDS FASTA

4419 bp · LXL04_038112|LXL04_038112|OH1004|CDS

ATGAAGAAGACGAAGCGGCCATTATCATTTTTACGCCATTGCTGCTTCCTTCTCTCCGTCTTCTCCATTTTTACCTCTTGCAGATCTAGTCCTTCACATAATTATGCCGACGCTCTCACTAAATCTCTGCTATACTTCGAAGCCCAGCGCTCCGGCCGCCTTCCGTACAACCAACGTGTCACATGGCGCGACAATTCCGGCCTCACCGACGGCCTTGAACAAGGCGTGGACTTGGTCGGAGGTTATTACGACGCCGGAGA...

Protein

Download Protein FASTA

1472 aa · LXL04_038112|LXL04_038112|OH1004|PROTEIN

MKKTKRPLSFLRHCCFLLSVFSIFTSCRSSPSHNYADALTKSLLYFEAQRSGRLPYNQRVTWRDNSGLTDGLEQGVDLVGGYYDAGDHVKFGLPMAFTVTMLSWSIIEYGEYIAGAGELEHAMEAIKWGTDYFIKAHTSPNVLWAEVGDGDTDHYCWQRPEDMTTSRQAYKIDENNPGSDLAGETAAAMAAASIVLKKTNPHYSHMLLHHAQQLFEFGDKYRGKYDESIGVVKNYYTSVSGHEDELLWAAMWLYKATDNR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_038112`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_038112

Location Chr09:31586736-31597225 (+)

Description Similar to At2g32990: Endoglucanase 11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g32990`	Endoglucanase 11.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0738600`	Endoglucanase 7.	No verified direct reference in this release
`Os09g0394300`	Endoglucanase 22.	No verified direct reference in this release
`Os02g0151300`	Endoglucanase 5.	No verified direct reference in this release
`Os06g0247900`	Endoglucanase 16.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038112 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0030245 cellulose catabolic process Biological Process

GO:0071555 cell wall organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0008810 cellulase activity Molecular Function

KEGG gene cross-reference

ath:AT2G32990

dosa:Os02g0151300

dosa:Os02g0738600

dosa:Os06g0247900

dosa:Os09g0394300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.487

Rank 1 · LXL04_038112 · OH-1004

Nucleus0.319

Rank 2 · LXL04_038112 · OH-1004

Cell membrane0.162

Rank 3 · LXL04_038112 · OH-1004

Endoplasmic reticulum0.085

Rank 4 · LXL04_038112 · OH-1004

Mitochondrion0.052

Rank 5 · LXL04_038112 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00759.26Glyco_hydro_935-497 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_038112	`PF00759.26`	Glyco_hydro_9	35	497	7e-166	553.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O48766`	Arabidopsis thaliana	Endoglucanase 11	73.239%	Swiss-Prot	weak database homology
`Q6Z5P2`	Oryza sativa subsp. japonica	Endoglucanase 7	67.427%	Swiss-Prot	weak database homology
`Q6H3Z9`	Oryza sativa subsp. japonica	Endoglucanase 22	66.316%	Swiss-Prot	weak database homology
`Q67UW5`	Oryza sativa subsp. japonica	Endoglucanase 5	66.320%	Swiss-Prot	weak database homology
`Q654U4`	Oryza sativa subsp. japonica	Endoglucanase 16	67.155%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card