TkA04G388630 | RubberDandelionOmics

Gene overview

TkA04G388630

Reference: TK1151 Chr: Chr04 Coordinates: 97763880-97765936 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1192 bp · TkA04G388630|TK1151|cDNA

CACGTGCCGTCTCCCCTTTCCCCATCGTCCCCACACCCTATAAATAACGTACAGACTTCCACCAAGCTACCATAACCGCCGTTGCCTCTCTCTGCTTTCAATCTCTCCCAAAATTTCTCCTTGCGATGAAACTAGACCAGGAACTCAACCAGCATGGCCGTGACATCATCAGAACAATCGAAGTAGTTCAATCCGTTAAGAAGCTATCAACTACAGCCGTTGATAACTTCGATTCGAATGGGGAAGAGCTCTACACGCCT...

CDS

Download CDS FASTA

624 bp · TkA04G388630|TK1151|CDS

ATGAAACTAGACCAGGAACTCAACCAGCATGGCCGTGACATCATCAGAACAATCGAAGTAGTTCAATCCGTTAAGAAGCTATCAACTACAGCCGTTGATAACTTCGATTCGAATGGGGAAGAGCTCTACACGCCTCCGCTTAATTTCTCCATGGTTGATAATGGCATATACCGTTCAGGATTCCCCGATACCTCCAACTTCTCGTTTCTCAAAACCCTAGGCCTTCGCTCTATCGTATATTTGTGTCCTGAACCATATCC...

Protein

Download Protein FASTA

207 aa · TkA04G388630|TK1151|PROTEIN

MKLDQELNQHGRDIIRTIEVVQSVKKLSTTAVDNFDSNGEELYTPPLNFSMVDNGIYRSGFPDTSNFSFLKTLGLRSIVYLCPEPYPEHNMEFLKADRIQLFQFGIEGTKEPFVNIPEDTIREALKVVLDVRNHPLLIHCKRGKHRTGCLVGCLRKIQRWCLTSIFDEYQRFAAGKARISDQRFIELFDTSGFKDIPPCPCSCSKRR

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G388630`
TK1151 ID	TkA04G388630
OH-1004 ID	LXL04_017580
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	73.500
Protein coverage (%)	TK1151 93.720 / OH-1004 99.490 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G388630

Location Chr04:97763880-97765936 (-)

Description Similar to DSP1: Tyrosine-protein phosphatase DSP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05000`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates.	Structural and functional characterization of a novel phosphatase from the Arabidopsis thaliana gene locus At1g05000.2008 · DOI: 10.1002/prot.22041 Phylogenetic and genetic linkage between novel atypical dual-specificity phosphatases from non-metazoan organisms.2011 · DOI: 10.1007/s00438-011-0611-6 A structural exposé of noncanonical molecular reactivity within the protein tyrosine phosphatase WPD loop.2022 · DOI: 10.1038/s41467-022-29673-y Arabidopsis PFA-DSP-Type Phosphohydrolases Target Specific Inositol Pyrophosphate Messengers.2022 · DOI: 10.1021/acs.biochem.2c00145
`At4g03960`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates.	No verified direct reference in this release
`At2g32960`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0135700`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates (By similarity).	OsPFA-DSP1, a rice protein tyrosine phosphatase, negatively regulates drought stress responses in transgenic tobacco and rice plants.2012 · DOI: 10.1007/s00299-011-1220-x
`Os02g0771400`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates (By similarity).	Two homologous putative protein tyrosine phosphatases, OsPFA-DSP2 and AtPFA-DSP4, negatively regulate the pathogen response in transgenic plants.2012 · DOI: 10.1371/journal.pone.0034995

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017580 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:1900424 regulation of defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016791 phosphatase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0052845 inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity Molecular Function

GO:0052847 inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity Molecular Function

GO:0052848 inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity Molecular Function

GO:0106211 inositol-5-diphosphate-1,3,4,6-tetrakisphosphate diphosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05000

ath:AT2G32960

ath:AT4G03960

dosa:Os02g0771400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.565

Rank 1 · TkA04G388630 · TK1151

Nucleus0.391

Rank 2 · TkA04G388630 · TK1151

Cell membrane0.084

Rank 3 · TkA04G388630 · TK1151

Plastid0.082

Rank 4 · TkA04G388630 · TK1151

Endoplasmic reticulum0.059

Rank 5 · TkA04G388630 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03162Y_phosphatase245-195 aa

PF22741PTP-NADK55-181 aa

PF22785Tc-R-P62-153 aa

PF22784PTP-SAK70-154 aa

PF13350Y_phosphatase3114-171 aa

PF00102Y_phosphatase125-159 aa

PF00782DSPc131-153 aa

PF23696YneP144-159 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G388630	`PF03162`	Y_phosphatase2	45	195	1.8e-64	217.0
TkA04G388630	`PF22741`	PTP-NADK	55	181	2.4e-08	34.3
TkA04G388630	`PF22785`	Tc-R-P	62	153	0.0032	18.7
TkA04G388630	`PF22784`	PTP-SAK	70	154	0.00037	21.3
TkA04G388630	`PF13350`	Y_phosphatase3	114	171	1.2e-06	29.4
TkA04G388630	`PF00102`	Y_phosphatase	125	159	0.0054	17.1
TkA04G388630	`PF00782`	DSPc	131	153	0.036	14.6
TkA04G388630	`PF23696`	YneP	144	159	0.098	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVN4`	Arabidopsis thaliana	sp\|Q9ZVN4\|DSP1_ARATH Inositol diphosphatase DSP1	69.000%	Swiss-Prot	High
`Q940L5`	Arabidopsis thaliana	sp\|Q940L5\|DSP4_ARATH Inositol diphosphatase DSP4	71.300%	Swiss-Prot	High
`Q84MD6`	Arabidopsis thaliana	sp\|Q84MD6\|DSP2_ARATH Inositol diphosphatase DSP2	55.300%	Swiss-Prot	High
`Q6K461`	Oryza sativa subsp. japonica	sp\|Q6K461\|DSP1_ORYSJ Inositol diphosphatase DSP1	76.100%	Swiss-Prot	High
`Q0DX67`	Oryza sativa subsp. japonica	sp\|Q0DX67\|DSP2_ORYSJ Inositol diphosphatase DSP2	68.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card