LXL04_017580 | RubberDandelionOmics

Gene overview

LXL04_017580

Reference: OH-1004 Chr: Chr03 Coordinates: 153967361-153969479 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

591 bp · LXL04_017580|LXL04_017580|OH1004|cDNA

ATGAAATTCCAGCAAGAAGGGAGACACGAAGGTGGTGACATGTGCAGAATCATGAACTTCGTTGAGCCGCTCCCCGCCCTATCAACAATGTCTACCGGAAAAGTTGATGCTAACGGCGACTGCGAGGAGCTCTATCCTCCGATCAACTTCTCCATGGTCGATTACGGCATCTACCGCTCCAGTTTCCCGGATTCCGCCAACTTCTCGTTCCTTAAATCGCTTGAACTTCGCTCAATCGTATATTTGTGTCCTGAGGCATA...

CDS

Download CDS FASTA

591 bp · LXL04_017580|LXL04_017580|OH1004|CDS

ATGAAATTCCAGCAAGAAGGGAGACACGAAGGTGGTGACATGTGCAGAATCATGAACTTCGTTGAGCCGCTCCCCGCCCTATCAACAATGTCTACCGGAAAAGTTGATGCTAACGGCGACTGCGAGGAGCTCTATCCTCCGATCAACTTCTCCATGGTCGATTACGGCATCTACCGCTCCAGTTTCCCGGATTCCGCCAACTTCTCGTTCCTTAAATCGCTTGAACTTCGCTCAATCGTATATTTGTGTCCTGAGGCATA...

Protein

Download Protein FASTA

196 aa · LXL04_017580|LXL04_017580|OH1004|PROTEIN

MKFQQEGRHEGGDMCRIMNFVEPLPALSTMSTGKVDANGDCEELYPPINFSMVDYGIYRSSFPDSANFSFLKSLELRSIVYLCPEAYPEHNLEFLKSNRIQLFHFGIEGTKESFYNIPEDTIREALKVVLDVRNHPLLIHCKRGKHRTGCLVGCLRKMQRWSLLSIFDEYHRFAAAKARVSDQRFMELFDASSLKW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_017580`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_017580

Location Chr03:153967361-153969479 (-)

Description Similar to DSP1: Tyrosine-protein phosphatase DSP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g05000`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates.	Structural and functional characterization of a novel phosphatase from the Arabidopsis thaliana gene locus At1g05000.2008 · DOI: 10.1002/prot.22041 Phylogenetic and genetic linkage between novel atypical dual-specificity phosphatases from non-metazoan organisms.2011 · DOI: 10.1007/s00438-011-0611-6 A structural exposé of noncanonical molecular reactivity within the protein tyrosine phosphatase WPD loop.2022 · DOI: 10.1038/s41467-022-29673-y Arabidopsis PFA-DSP-Type Phosphohydrolases Target Specific Inositol Pyrophosphate Messengers.2022 · DOI: 10.1021/acs.biochem.2c00145
`At4g03960`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates.	No verified direct reference in this release
`At2g32960`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0135700`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates (By similarity).	OsPFA-DSP1, a rice protein tyrosine phosphatase, negatively regulates drought stress responses in transgenic tobacco and rice plants.2012 · DOI: 10.1007/s00299-011-1220-x
`Os02g0771400`	Cleaves the beta-phosphate at the 5-position of soluble inositol pyrophosphates (By similarity).	Two homologous putative protein tyrosine phosphatases, OsPFA-DSP2 and AtPFA-DSP4, negatively regulate the pathogen response in transgenic plants.2012 · DOI: 10.1371/journal.pone.0034995

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017580 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006952 defense response Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:1900424 regulation of defense response to bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016791 phosphatase activity Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0052845 inositol-5-diphosphate-1,2,3,4,6-pentakisphosphate diphosphatase activity Molecular Function

GO:0052847 inositol-1,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity Molecular Function

GO:0052848 inositol-3,5-bisdiphosphate-2,3,4,6-tetrakisphosphate 5-diphosphatase activity Molecular Function

GO:0106211 inositol-5-diphosphate-1,3,4,6-tetrakisphosphate diphosphatase activity Molecular Function

KEGG gene cross-reference

ath:AT1G05000

ath:AT2G32960

ath:AT4G03960

dosa:Os02g0771400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.550

Rank 1 · LXL04_017580 · OH-1004

Nucleus0.386

Rank 2 · LXL04_017580 · OH-1004

Plastid0.113

Rank 3 · LXL04_017580 · OH-1004

Cell membrane0.071

Rank 4 · LXL04_017580 · OH-1004

Endoplasmic reticulum0.057

Rank 5 · LXL04_017580 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03162.19Y_phosphatase246-193 aa

PF22741.2PTP-NADK119-165 aa

PF13350.12Y_phosphatase3119-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_017580	`PF03162.19`	Y_phosphatase2	46	193	2e-61	207.1
LXL04_017580	`PF22741.2`	PTP-NADK	119	165	2.2e-07	31.2
LXL04_017580	`PF13350.12`	Y_phosphatase3	119	175	1.1e-06	29.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZVN4`	Arabidopsis thaliana	Inositol diphosphatase DSP1	66.667%	Swiss-Prot	strong database homology
`Q940L5`	Arabidopsis thaliana	Inositol diphosphatase DSP4	68.485%	Swiss-Prot	strong database homology
`Q84MD6`	Arabidopsis thaliana	Inositol diphosphatase DSP2	51.931%	Swiss-Prot	strong database homology
`Q6K461`	Oryza sativa subsp. japonica	Inositol diphosphatase DSP1	74.342%	Swiss-Prot	strong database homology
`Q0DX67`	Oryza sativa subsp. japonica	Inositol diphosphatase DSP2	70.199%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card