RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA04G388530
Reference: TK1151 Chr: Chr04 Coordinates: 97727921-97730834 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1923 bp · TkA04G388530|TK1151|cDNA

ATGTTGTTTTTGGTGCAGATTAAGGTTGGAGACAAAATCAGGCGCCTGCATGCAGCAGGATTTGATTATCTTCATCACCTGGACACATTAGAGGAGAGTATTTCCATCCTCTTTGCTCTAGACCTCAATGCCGATTGCATACAGGGTCTGAATCTAAGAAGAAGGCACCAAAACAATCAAAACCAGTACCCTACACAGCCGGAGATCAATCACGGTTCTGCAGCACCGGCGGCGGTGGCTACGAACCCTAGGTATCCTAG...

CDS

Download CDS FASTA

1923 bp · TkA04G388530|TK1151|CDS

ATGTTGTTTTTGGTGCAGATTAAGGTTGGAGACAAAATCAGGCGCCTGCATGCAGCAGGATTTGATTATCTTCATCACCTGGACACATTAGAGGAGAGTATTTCCATCCTCTTTGCTCTAGACCTCAATGCCGATTGCATACAGGGTCTGAATCTAAGAAGAAGGCACCAAAACAATCAAAACCAGTACCCTACACAGCCGGAGATCAATCACGGTTCTGCAGCACCGGCGGCGGTGGCTACGAACCCTAGGTATCCTAG...

Protein

Download Protein FASTA

640 aa · TkA04G388530|TK1151|PROTEIN

MLFLVQIKVGDKIRRLHAAGFDYLHHLDTLEESISILFALDLNADCIQGLNLRRRHQNNQNQYPTQPEINHGSAAPAAVATNPRYPSWREEVVALNKGISINKETVKIKRDQEDPEKYLVQFTYDANDDGIIILHFGSKRGDGSSDGLTKEDLIPSIKLHIQKGFGQKFIQESGTGIDLSTYKVDVQEVYMLVIQAATYGPISSKDYVFQFTSATFKKEEGECHIRVVHQFLRMNGVRYVLHDIYGDTDDEARNDRLEGS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA04G388530
TK1151 IDTkA04G388530
OH-1004 IDLXL04_038096
Relationship / confidenceRbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)75.900
Protein coverage (%)TK1151 53.906 / OH-1004 54.397
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA04G388530
LocationChr04:97727921-97730834 (-)
DescriptionSimilar to IRE1A: Serine/threonine-protein kinase/endoribonuclease IRE1a
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g24360 Senses unfolded proteins in the lumen of the endoplasmic reticulum via its N-terminal domain which leads to enzyme auto- activation.
Heat induces the splicing by IRE1 of a mRNA encoding a transcription factor involved in the unfolded protein response in Arabidopsis.2011 · DOI: 10.1073/pnas.1102117108
AtIRE1A/AtIRE1B and AGB1 independently control two essential unfolded protein response pathways in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2011.04788.x
Arabidopsis IRE1 catalyses unconventional splicing of bZIP60 mRNA to produce the active transcription factor.2011 · DOI: 10.1038/srep00029
IRE1/bZIP60-mediated unfolded protein response plays distinct roles in plant immunity and abiotic stress responses.2012 · DOI: 10.1371/journal.pone.0031944
Alteration of the bZIP60/IRE1 pathway affects plant response to ER stress in Arabidopsis thaliana.2012 · DOI: 10.1371/journal.pone.0039023
Degradation of the endoplasmic reticulum by autophagy during endoplasmic reticulum stress in Arabidopsis.2012 · DOI: 10.1105/tpc.112.101535
At2g17520 Senses unfolded proteins in the lumen of the endoplasmic reticulum via its N-terminal domain which leads to enzyme auto- activation.
Characterization of two homologs of Ire1p, a kinase/endoribonuclease in yeast, in Arabidopsis thaliana.2002 · DOI: 10.1016/s0167-4781(02)00237-3
AtIRE1A/AtIRE1B and AGB1 independently control two essential unfolded protein response pathways in Arabidopsis.2012 · DOI: 10.1111/j.1365-313x.2011.04788.x
Arabidopsis IRE1 catalyses unconventional splicing of bZIP60 mRNA to produce the active transcription factor.2011 · DOI: 10.1038/srep00029
IRE1/bZIP60-mediated unfolded protein response plays distinct roles in plant immunity and abiotic stress responses.2012 · DOI: 10.1371/journal.pone.0031944

Rice

Reference gene IDPossible functionPapers / DOI
Os07g0471000 Involved in endoplasmic reticulum (ER) stress response.
Signal transduction by IRE1-mediated splicing of bZIP50 and other stress sensors in the endoplasmic reticulum stress response of rice.2012 · DOI: 10.1111/j.1365-313x.2011.04844.x
Conservation of IRE1-regulated bZIP74 mRNA unconventional splicing in rice (Oryza sativa L.) involved in ER stress responses.2012 · DOI: 10.1093/mp/ssr115
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_038096 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000394 RNA splicing, via endonucleolytic cleavage and ligation Biological Process
GO:0002376 immune system process Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006397 mRNA processing Biological Process
GO:0006914 autophagy Biological Process
GO:0006986 response to unfolded protein Biological Process
GO:0008380 RNA splicing Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0030968 endoplasmic reticulum unfolded protein response Biological Process
GO:0034263 positive regulation of autophagy in response to ER overload Biological Process
GO:0034976 response to endoplasmic reticulum stress Biological Process
GO:0035966 response to topologically incorrect protein Biological Process
KEGG gene cross-reference
ath:AT2G17520
ath:AT3G11870
ath:AT5G24360
cel:CELE_C41C4.4
dosa:Os07g0471000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.547
Rank 1 · TkA04G388530 · TK1151
Nucleus0.355
Rank 2 · TkA04G388530 · TK1151
Cell membrane0.118
Rank 3 · TkA04G388530 · TK1151
Mitochondrion0.079
Rank 4 · TkA04G388530 · TK1151
Endoplasmic reticulum0.077
Rank 5 · TkA04G388530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08936CsoSCA_C7-54 aa
PF06293Kdo8-22 aa
PF26192RNF157-like_N100-241 aa
PF00069Pkinase259-517 aa
PF07714PK_Tyr_Ser-Thr266-511 aa
PF17667Pkinase_fungal357-446 aa
PF06293Kdo369-402 aa
PF08936CsoSCA_C435-459 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA04G388530PF08936CsoSCA_C7540.1712.4
TkA04G388530PF06293Kdo8220.06613.4
TkA04G388530PF26192RNF157-like_N1002413.1e-29103.0
TkA04G388530PF00069Pkinase2595172.9e-40139.0
TkA04G388530PF07714PK_Tyr_Ser-Thr2665111.1e-30107.5
TkA04G388530PF17667Pkinase_fungal3574462.4e-0524.0
TkA04G388530PF06293Kdo3694020.06613.4
TkA04G388530PF08936CsoSCA_C4354590.1712.4
TkA04G388530PF06479Ribonuc_2-5A5176351.7e-2796.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93VJ2Arabidopsis thalianasp|Q93VJ2|IRE1B_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1b44.200%Swiss-ProtMedium
Q9C5S2Arabidopsis thalianasp|Q9C5S2|IRE1A_ARATH Serine/threonine-protein kinase/endoribonuclease IRE1a47.000%Swiss-ProtMedium
Q7XIT1Oryza sativa subsp. japonicasp|Q7XIT1|IRE1_ORYSJ Serine/threonine-protein kinase/endoribonuclease IRE147.800%Swiss-ProtMedium

JBrowse

View in Genome Browser