TkA04G374010 | RubberDandelionOmics

Gene overview

TkA04G374010

Reference: TK1151 Chr: Chr04 Coordinates: 94012470-94014355 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1140 bp · TkA04G374010|TK1151|cDNA

TTAATTTGTGTCCCGCCGCATTGCGCGGATACACAACTAGTAAGAAAAAAAAAGACAAAATTTGATTCTCTTTACATCTATTTTTTACGGAAAAAATACTGAGAAAATGCAAGTTTTATCGAAGAAATAAAGTAATAAACAAAAGAAAGGGGCAATCTCTTCACGTTCCAAGTTCGAACCCTACCTCCATCCGCCCCAACGATTTTAGCTTCTACTCGGCTACAAGTTCGAAACCTACCTTCATATCTCCCAGCGATTCT...

CDS

Download CDS FASTA

546 bp · TkA04G374010|TK1151|CDS

ATGGATGATGACAGTAACAACAGTTTTGAATCCAAGAAAATAGTTTTTGTGACAGTTGGCACAACATCTTTTGATTCTCTTGTTAAAAGTGTGGACACTGAGCAAGTTAAACAAGAGTTATTTAAGAAAGGATACACTCACCTTGTTATTCAAATGGGTCGCGGATCCTACATTCCTAAAAAGTCTAGTGGTGAAGAAGATGGATCATCATTGGTTGTAGATTACTTCACTTTTTCCTCAAGCATTGCAGACTATTTGAA...

Protein

Download Protein FASTA

181 aa · TkA04G374010|TK1151|PROTEIN

MDDDSNNSFESKKIVFVTVGTTSFDSLVKSVDTEQVKQELFKKGYTHLVIQMGRGSYIPKKSSGEEDGSSLVVDYFTFSSSIADYLKSSSLVISHAGSGSIFETLRLGKPLIVVVNEDLMDNHQSELAEELAERKHLFCGSPQSLYKVIQSMELESIIPYHPGDATPVAKLINRYLGFPSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G374010`
TK1151 ID	TkA04G374010
OH-1004 ID	LXL04_038007
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G374010`
Location	Chr04:94012470-94014355 (+)
Description	Similar to Alg13: UDP-N-acetylglucosamine transferase subunit ALG13 homolog
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_038007` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006487 protein N-linked glycosylation Biological Process GO:0006488 dolichol-linked oligosaccharide biosynthetic process Biological Process GO:0006508 proteolysis Biological Process GO:1904262 negative regulation of TORC1 signaling Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0005829 cytosol Cellular Component GO:0043541 UDP-N-acetylglucosamine transferase complex Cellular Component GO:0098548 cytoplasmic side of Golgi membrane Cellular Component GO:0098554 cytoplasmic side of endoplasmic reticulum membrane Cellular Component
KEGG gene cross-reference	hsa:79868 mmu:67574 rno:300284 sce:YGL047W spo:2543352 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.755

Rank 1 · TkA04G374010 · TK1151

Nucleus0.443

Rank 2 · TkA04G374010 · TK1151

Mitochondrion0.059

Rank 3 · TkA04G374010 · TK1151

Peroxisome0.055

Rank 4 · TkA04G374010 · TK1151

Endoplasmic reticulum0.046

Rank 5 · TkA04G374010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18242LupA12-67 aa

PF04101Glyco_tran_28_C14-164 aa

PF18242LupA151-176 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G374010	`PF18242`	LupA	12	67	0.11	12.8
TkA04G374010	`PF04101`	Glyco_tran_28_C	14	164	7.1e-32	111.5
TkA04G374010	`PF18242`	LupA	151	176	0.11	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card