TkA04G373910 | RubberDandelionOmics

Gene overview

TkA04G373910

Reference: TK1151 Chr: Chr04 Coordinates: 93988071-93991253 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1687 bp · TkA04G373910|TK1151|cDNA

AATTCGAAGGTCATTCTTTCTATTTATTTTCTAAAAATCAAAATAAATGTCCTTCGTCTTGTCGTTTTATTGGAACATTACATTTTGACTCACCGTATTGTTTAGAAAACCGTTCAAAAGCATATCGTTCGATTTAATGGCAAAACGACGTCACATTATAAACAATACTTCACTACGTCAATGCACATAATTTTCTCGTGCACCTCTGTAGTTCTCCTCATCACAAGTCATTCCCATATATAGCCATGGCCGGTTAACTC...

CDS

Download CDS FASTA

891 bp · TkA04G373910|TK1151|CDS

ATGCCGTCTGCAGATGCTGAGACATCTGATCAGGACCGAGAACAGTTTGTTGAGGTCGATCCATCAGGAAGATTTGGGCGGTACAGCGACCTATTGGGAGCTGGTGCAGTGAAGAAGGTGTACAGAGGATTCGATCAAGAAGAAGGTAGAGACGTGGCCTGGAACCAAGTAAAACTCAGAAGCTTCAGTGGAGATCCGTCTGTTCTCAAGAGACTGTTTTCAGAAATCAAACTGTTGAAGACACTAGAGAACGAAAACAT...

Protein

Download Protein FASTA

296 aa · TkA04G373910|TK1151|PROTEIN

MPSADAETSDQDREQFVEVDPSGRFGRYSDLLGAGAVKKVYRGFDQEEGRDVAWNQVKLRSFSGDPSVLKRLFSEIKLLKTLENENIIVLYSFWRDTKNSTLNFITEACASGNLRDYRKKHRRVSLKALKNWSRQILRGLEYLHNHEPCIIHRDLNCSNIFINGNIGKVKIGDLGLAAVVGKNHNAHTLLGTPEYMAPELYEEDYNELVDIYSFGMCLLEMATMEIPYSECDSIAKIYRKVTSGVMPQAFNKVTDHELKS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G373910`
TK1151 ID	TkA04G373910
OH-1004 ID	LXL04_017627
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	84.400
Protein coverage (%)	TK1151 99.662 / OH-1004 99.327 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G373910

Location Chr04:93988071-93991253 (+)

Description Similar to WNK11: Probable serine/threonine-protein kinase WNK11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g55560`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release
`At3g48260`	May regulate flowering time by modulating the photoperiod pathway.	No verified direct reference in this release
`At3g04910`	Regulates flowering time by modulating the photoperiod pathway.	The APRR3 component of the clock-associated APRR1/TOC1 quintet is phosphorylated by a novel protein kinase belonging to the WNK family, the gene for which is also transcribed rhythmically in Arabidopsis thaliana.2002 · DOI: 10.1093/pcp/pcf084 Compilation and characterization of a novel WNK family of protein kinases in Arabiodpsis thaliana with reference to circadian rhythms.2002 · DOI: 10.1271/bbb.66.2429 The plant WNK gene family and regulation of flowering time in Arabidopsis.2008 · DOI: 10.1111/j.1438-8677.2008.00072.x
`At3g22420`	Regulates flowering time by modulating the photoperiod pathway.	The plant WNK gene family and regulation of flowering time in Arabidopsis.2008 · DOI: 10.1111/j.1438-8677.2008.00072.x

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0584100`	Probable serine/threonine-protein kinase WNK5.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_017627 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006468 protein phosphorylation Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT3G04910

ath:AT3G48260

ath:AT5G28080

ath:AT5G55560

dosa:Os07g0584100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.583

Rank 1 · TkA04G373910 · TK1151

Nucleus0.536

Rank 2 · TkA04G373910 · TK1151

Cell membrane0.083

Rank 3 · TkA04G373910 · TK1151

Mitochondrion0.052

Rank 4 · TkA04G373910 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkA04G373910 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00069Pkinase30-284 aa

PF07714PK_Tyr_Ser-Thr30-280 aa

PF08740BCS1_N50-96 aa

PF06293Kdo70-164 aa

PF01636APH119-165 aa

PF17667Pkinase_fungal136-214 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G373910	`PF00069`	Pkinase	30	284	4.3e-51	174.5
TkA04G373910	`PF07714`	PK_Tyr_Ser-Thr	30	280	1.9e-35	123.1
TkA04G373910	`PF08740`	BCS1_N	50	96	0.013	16.1
TkA04G373910	`PF06293`	Kdo	70	164	0.078	13.1
TkA04G373910	`PF01636`	APH	119	165	0.093	13.2
TkA04G373910	`PF17667`	Pkinase_fungal	136	214	0.00064	19.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q6ICW6`	Arabidopsis thaliana	sp\|Q6ICW6\|WNK11_ARATH Probable serine/threonine-protein kinase WNK11	72.300%	Swiss-Prot	High
`Q9STK6`	Arabidopsis thaliana	sp\|Q9STK6\|WNK3_ARATH Probable serine/threonine-protein kinase WNK3	62.000%	Swiss-Prot	High
`Q9CAV6`	Arabidopsis thaliana	sp\|Q9CAV6\|WNK1_ARATH Serine/threonine-protein kinase WNK1	60.800%	Swiss-Prot	High
`Q8S8Y9`	Arabidopsis thaliana	sp\|Q8S8Y9\|WNK2_ARATH Serine/threonine-protein kinase WNK2	58.000%	Swiss-Prot	High
`Q0D541`	Oryza sativa subsp. japonica	sp\|Q0D541\|WNK5_ORYSJ Probable serine/threonine-protein kinase WNK5	63.400%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card