TkA04G369070 | RubberDandelionOmics

Gene overview

TkA04G369070

Reference: TK1151 Chr: Chr04 Coordinates: 92792107-92793254 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · TkA04G369070|TK1151|cDNA

ATGTTTAATCAATGGTTTAGATCTTCACCAACACCACTTCACACGGATCACCATTACAATTTCACTCGGATCACCCGGAGCGCCATTCCTCCGACACCAGCCTCGATCTTCACCAGCTCCTCTCCACGCTTGCACGCCGATTCACTTGCACGCCAGACGATTTCCATCTCTATATTTATCCTCCCGATTTCAAATGGAGATGAAATTGGTTTTCGATTCCATCCCAATTTCACCTCCGACACACACAGGTATGGTTTCGT...

CDS

Download CDS FASTA

648 bp · TkA04G369070|TK1151|CDS

ATGTTTAATCAATGGTTTAGATCTTCACCAACACCACTTCACACGGATCACCATTACAATTTCACTCGGATCACCCGGAGCGCCATTCCTCCGACACCAGCCTCGATCTTCACCAGCTCCTCTCCACGCTTGCACGCCGATTCACTTGCACGCCAGACGATTTCCATCTCTATATTTATCCTCCCGATTTCAAATGGAGATGAAATTGGTTTTCGATTCCATCCCAATTTCACCTCCGACACACACAGGTATGGTTTCGT...

Protein

Download Protein FASTA

215 aa · TkA04G369070|TK1151|PROTEIN

MFNQWFRSSPTPLHTDHHYNFTRITRSAIPPTPASIFTSSSPRLHADSLARQTISISIFILPISNGDEIGFRFHPNFTSDTHRYGFVLSSTLSSSFHNNRTSIIFAAQISLMHHLDDSTISLPLHRHHHRITLTAPPSHRSGTPSQVCSSMAEHLASIFGTEKDRVNCPFYFKIGACRHGDRCSSLHTTSSTFVYMQTAVLPMVKLPVCYSFYHG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G369070`
TK1151 ID	TkA04G369070
OH-1004 ID	LXL04_020562
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	97.400
Protein coverage (%)	TK1151 54.419 / OH-1004 31.536 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G369070

Location Chr04:92792107-92793254 (+)

Description Similar to Tbc1d8b: TBC1 domain family member 8B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g42820`	Necessary for the splicing of pre-mRNA (By similarity).	No verified direct reference in this release
`At1g27650`	Necessary for the splicing of pre-mRNA (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0564200`	Necessary for the splicing of pre-mRNA.	No verified direct reference in this release
`Os09g0491756`	Necessary for the splicing of pre-mRNA.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_020562 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003008 system process Biological Process

GO:0003094 glomerular filtration Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0005829 cytosol Cellular Component

GO:0005096 GTPase activator activity Molecular Function

GO:0005509 calcium ion binding Molecular Function

KEGG gene cross-reference

dre:566657

hsa:23158

hsa:54885

mmu:245638

mmu:71310

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.561

Rank 1 · TkA04G369070 · TK1151

Cytoplasm0.412

Rank 2 · TkA04G369070 · TK1151

Cell membrane0.064

Rank 3 · TkA04G369070 · TK1151

Mitochondrion0.060

Rank 4 · TkA04G369070 · TK1151

Endoplasmic reticulum0.059

Rank 5 · TkA04G369070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23192NOMO_12th71-114 aa

PF16131Torus161-189 aa

PF25585zf-CCCH_DUS3L163-187 aa

PF00642zf-CCCH164-187 aa

PF18345zf_CCCH_4168-187 aa

PF18044zf-CCCH_4168-183 aa

PF23192NOMO_12th190-196 aa

PF00642zf-CCCH206-213 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G369070	`PF23192`	NOMO_12th	71	114	0.13	13.7
TkA04G369070	`PF16131`	Torus	161	189	0.23	12.7
TkA04G369070	`PF25585`	zf-CCCH_DUS3L	163	187	0.028	15.1
TkA04G369070	`PF00642`	zf-CCCH	164	187	5e-07	30.2
TkA04G369070	`PF18345`	zf_CCCH_4	168	187	0.0087	16.8
TkA04G369070	`PF18044`	zf-CCCH_4	168	183	0.061	13.8
TkA04G369070	`PF23192`	NOMO_12th	190	196	0.13	13.7
TkA04G369070	`PF00642`	zf-CCCH	206	213	5e-07	30.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMY5`	Arabidopsis thaliana	sp\|Q9FMY5\|U2AFB_ARATH Splicing factor U2af small subunit B	97.300%	Swiss-Prot	Low
`Q9S709`	Arabidopsis thaliana	sp\|Q9S709\|U2AFA_ARATH Splicing factor U2af small subunit A	97.300%	Swiss-Prot	Low
`Q6AUG0`	Oryza sativa subsp. japonica	sp\|Q6AUG0\|U2AFB_ORYSJ Splicing factor U2af small subunit B	85.100%	Swiss-Prot	Low
`Q9ZQW8`	Oryza sativa subsp. japonica	sp\|Q9ZQW8\|U2AFA_ORYSJ Splicing factor U2af small subunit A	90.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card