TkA04G358230 | RubberDandelionOmics

Gene overview

TkA04G358230

Reference: TK1151 Chr: Chr04 Coordinates: 90253790-90255578 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

675 bp · TkA04G358230|TK1151|cDNA

ATGTTTGGATCGGACGCACTGATTCTCAAGCCAGAAATTTATGTGTTTTCGTTTGAAATCTATTTCAGACACGAGAAATGTGATAATGAATCTTTACTTGATACAATTCGAATCTTGAAGCTGAAATCTTCAAAGCATGAACAAGAAGGGAGAGTCCATTCTGCTAGAAGCATTGATGGAGTTATATATTCCATATGGTCTTTACTGCCTTCATTTTGCAACTACCCTCTTGATACTGCTGAAAGTTACGAGGATTTGGA...

CDS

Download CDS FASTA

675 bp · TkA04G358230|TK1151|CDS

ATGTTTGGATCGGACGCACTGATTCTCAAGCCAGAAATTTATGTGTTTTCGTTTGAAATCTATTTCAGACACGAGAAATGTGATAATGAATCTTTACTTGATACAATTCGAATCTTGAAGCTGAAATCTTCAAAGCATGAACAAGAAGGGAGAGTCCATTCTGCTAGAAGCATTGATGGAGTTATATATTCCATATGGTCTTTACTGCCTTCATTTTGCAACTACCCTCTTGATACTGCTGAAAGTTACGAGGATTTGGA...

Protein

Download Protein FASTA

224 aa · TkA04G358230|TK1151|PROTEIN

MFGSDALILKPEIYVFSFEIYFRHEKCDNESLLDTIRILKLKSSKHEQEGRVHSARSIDGVIYSIWSLLPSFCNYPLDTAESYEDLEKVLWHTFCQEPDLRGVICSSLQILIRQNKTIVDGESQSQSQSEKVSVCEQRAVSRYALEVTTRNLDVLRLSAHDILSTLGGIFRKSDKDDGGSIQKTIGEFASIADKGLYEQKEADRRAKPEEIANRRRKREQDPKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G358230`
TK1151 ID	TkA04G358230
OH-1004 ID	LXL04_037884
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	98.600
Protein coverage (%)	TK1151 99.107 / OH-1004 96.491 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA04G358230`
Location	Chr04:90253790-90255578 (-)
Description	Similar to Rrp12: RRP12-like protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_037884` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0005840 ribosome Cellular Component GO:0005886 plasma membrane Cellular Component GO:0030686 90S preribosome Cellular Component GO:0030688 preribosome, small subunit precursor Cellular Component GO:0031965 nuclear membrane Cellular Component GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	dre:563195 gga:423845 hsa:23223 mmu:107094 sce:YPL012W These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.862

Rank 1 · TkA04G358230 · TK1151

Cytoplasm0.203

Rank 2 · TkA04G358230 · TK1151

Cell membrane0.028

Rank 3 · TkA04G358230 · TK1151

Mitochondrion0.024

Rank 4 · TkA04G358230 · TK1151

Endoplasmic reticulum0.016

Rank 5 · TkA04G358230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08161RRP12_HEAT30-171 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G358230	`PF08161`	RRP12_HEAT	30	171	2.8e-24	86.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card