TkA04G345170 | RubberDandelionOmics

Gene overview

TkA04G345170

Reference: TK1151 Chr: Chr04 Coordinates: 87282352-87284026 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1044 bp · TkA04G345170|TK1151|cDNA

AGCCGCGATCGACCACCTGTTTTCTCTCGTTTCCCATTTCCGGCGACCACTCCGGCGAGGCACCATCAAATTTCCGGCGACCAGTCTGTCTTCTCCTTCGCTGGAACGGTTAGGGTTTGTCTCGTGCACTCCGACGAGAAGCTGCCTCCTGCGCCATCTTCCTCGTTTATCTGGTCAACAACCCTTCTTCTTCTCGACACTGCAAACCGGCCTCCCCCCGACCTCCACCTTCTTCGCTGCTGCACCCAAAGCTCCGACGC...

CDS

Download CDS FASTA

624 bp · TkA04G345170|TK1151|CDS

ATGCATCGTAGCTCAATTCTCGAAATGGACATTAATACCCCTGGACTTCGTAAGCTTCAAGGAAGAAATCAGTTAAAGGACCTTGTTGAGAAGGTTCAAGCAGCTCGTAATGAAATGCAATGGGGTGATGAGGTCCCACCTCCATTGCTGGTTAAAATTGCTCCGGATTTGTCTAAGGAAGACCTTGAAGATATTGCAGCAGTTGCGCTTGCTCTCCAATTGGATGGTTTGATTATATCAAATACAACTATTTCAAGACC...

Protein

Download Protein FASTA

207 aa · TkA04G345170|TK1151|PROTEIN

MHRSSILEMDINTPGLRKLQGRNQLKDLVEKVQAARNEMQWGDEVPPPLLVKIAPDLSKEDLEDIAAVALALQLDGLIISNTTISRPQWEWEGGGGGDTGGAGAEEVYGGGWCGVRSNKEGQRRLGSRLFRFIVSAWKYCGCISFLYLDMFKKNVRMLLACYIYSVCLFQIVVKCLRQFDLKVCCSLYKFMVRYKFIQNLLIYRSSQ

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G345170`
TK1151 ID	TkA04G345170
OH-1004 ID	LXL04_033531
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	77.300
Protein coverage (%)	TK1151 46.860 / OH-1004 4.855 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G345170

Location Chr04:87282352-87284026 (+)

Description Similar to PYRD: Dihydroorotate dehydrogenase (quinone), mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23300`	Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0676300`	Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033531 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process Biological Process

GO:0006225 UDP biosynthetic process Biological Process

GO:0009220 pyrimidine ribonucleotide biosynthetic process Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0031000 response to caffeine Biological Process

GO:0042594 response to starvation Biological Process

GO:0044205 'de novo' UMP biosynthetic process Biological Process

GO:0090140 regulation of mitochondrial fission Biological Process

GO:1903576 response to L-arginine Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT5G23300

azc:AZC_4640

dosa:Os04g0676300

mmu:56749

rno:65156

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.402

Rank 1 · TkA04G345170 · TK1151

Nucleus0.350

Rank 2 · TkA04G345170 · TK1151

Mitochondrion0.199

Rank 3 · TkA04G345170 · TK1151

Endoplasmic reticulum0.103

Rank 4 · TkA04G345170 · TK1151

Cell membrane0.089

Rank 5 · TkA04G345170 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01180DHO_dh12-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G345170	`PF01180`	DHO_dh	12	91	1e-12	48.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P32746`	Arabidopsis thaliana	sp\|P32746\|PYRD_ARATH Dihydroorotate dehydrogenase (quinone), mitochondrial	70.100%	Swiss-Prot	Low
`Q7XKC8`	Oryza sativa subsp. japonica	sp\|Q7XKC8\|PYRD_ORYSJ Dihydroorotate dehydrogenase (quinone), mitochondrial	88.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card