LXL04_033531 | RubberDandelionOmics

Gene overview

LXL04_033531

Reference: OH-1004 Chr: Chr07 Coordinates: 46351758-46367884 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5997 bp · LXL04_033531|LXL04_033531|OH1004|cDNA

atgatgatgagaaagagtcataagaacaatagtacaaagaacatgatcattgagctaggtttggtcttccaaaacctcaaactagctaatgagatgaatgaaacaagtaagggggagctaaaagaaggaggattAGCAAGTGTACAAGCTatccaaagacttctacaagctaaggtaaaggcgATAGGCATAGGACTTGGTGTACAAATGACGGGAAGATTTGCATTTAGATTCATGAAAGGATCATTGACACAAAAGCT...

CDS

Download CDS FASTA

5997 bp · LXL04_033531|LXL04_033531|OH1004|CDS

ATGATGATGAGAAAGAGTCATAAGAACAATAGTACAAAGAACATGATCATTGAGCTAGGTTTGGTCTTCCAAAACCTCAAACTAGCTAATGAGATGAATGAAACAAGTAAGGGGGAGCTAAAAGAAGGAGGATTAGCAAGTGTACAAGCTATCCAAAGACTTCTACAAGCTAAGGTAAAGGCGATAGGCATAGGACTTGGTGTACAAATGACGGGAAGATTTGCATTTAGATTCATGAAAGGATCATTGACACAAAAGCT...

Protein

Download Protein FASTA

1998 aa · LXL04_033531|LXL04_033531|OH1004|PROTEIN

MMMRKSHKNNSTKNMIIELGLVFQNLKLANEMNETSKGELKEGGLASVQAIQRLLQAKVKAIGIGLGVQMTGRFAFRFMKGSLTQKLKSMAFPVANHRRYSSSSSSATAAAKPNISQSSRRDRLLAGTTVGLVGGAYASTLDEATFCGWLFTATKVLNPIFALLDPEVAHRLAISAAARAWVPRERRPDQQILGLEVWGRRFSNPIGLAAGFDKNAEAVEGLLGLGFGFVEVGSVTPLPQEGNPKPRMFRLRDQGAIINR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_033531`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_033531

Location Chr07:46351758-46367884 (+)

Description Similar to PYRD: Dihydroorotate dehydrogenase (quinone), mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23300`	Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0676300`	Catalyzes the conversion of dihydroorotate to orotate with quinone as electron acceptor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_033531 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006207 'de novo' pyrimidine nucleobase biosynthetic process Biological Process

GO:0006225 UDP biosynthetic process Biological Process

GO:0009220 pyrimidine ribonucleotide biosynthetic process Biological Process

GO:0009410 response to xenobiotic stimulus Biological Process

GO:0031000 response to caffeine Biological Process

GO:0042594 response to starvation Biological Process

GO:0044205 'de novo' UMP biosynthetic process Biological Process

GO:0090140 regulation of mitochondrial fission Biological Process

GO:1903576 response to L-arginine Biological Process

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT5G23300

azc:AZC_4640

dosa:Os04g0676300

mmu:56749

rno:65156

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.378

Rank 1 · LXL04_033531 · OH-1004

Nucleus0.168

Rank 2 · LXL04_033531 · OH-1004

Mitochondrion0.149

Rank 3 · LXL04_033531 · OH-1004

Cell membrane0.134

Rank 4 · LXL04_033531 · OH-1004

Cytoplasm0.130

Rank 5 · LXL04_033531 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01180.28DHO_dh194-501 aa

PF01582.26TIR680-855 aa

PF13676.12TIR_2683-779 aa

PF00931.29NB-ARC876-1050 aa

PF23282.2WHD_ROQ11119-1190 aa

PF13855.13LRR_81463-1517 aa

PF12799.14LRR_41487-1528 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_033531	`PF01180.28`	DHO_dh	194	501	3e-86	289.9
LXL04_033531	`PF01582.26`	TIR	680	855	9.9e-44	150.0
LXL04_033531	`PF13676.12`	TIR_2	683	779	2.1e-17	64.5
LXL04_033531	`PF00931.29`	NB-ARC	876	1050	4.2e-14	53.2
LXL04_033531	`PF23282.2`	WHD_ROQ1	1119	1190	6.9e-17	62.1
LXL04_033531	`PF13855.13`	LRR_8	1463	1517	2e-07	31.4
LXL04_033531	`PF12799.14`	LRR_4	1487	1528	1.4e-08	35.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P32746`	Arabidopsis thaliana	Dihydroorotate dehydrogenase (quinone), mitochondrial	73.576%	Swiss-Prot	weak database homology
`Q7XKC8`	Oryza sativa subsp. japonica	Dihydroorotate dehydrogenase (quinone), mitochondrial	75.369%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card