TkA04G343830 | RubberDandelionOmics

Gene overview

TkA04G343830

Reference: TK1151 Chr: Chr04 Coordinates: 86896555-86898643 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1645 bp · TkA04G343830|TK1151|cDNA

GAGCTTTTCAACGACGGCATACGATACGTGTCTCGGACCCTTTCCAGCCAAACCCTACTCCTTGGAATAATAGAATTCCTCATTGGCAGGGCATCCATCATCAATCCCCCCTTTCTCTCTCTCACGATCTTCCCTTTTTCTTAATTTTATATAGTTTGTTGATTTATAATCGGCTCATCCATTACCTCGATCGCCAATCGATCGACCAAAAACCACTGATTGGTTTCGAGGCATTCAAAACCCAAAATATTTTACATTTC...

CDS

Download CDS FASTA

1185 bp · TkA04G343830|TK1151|CDS

ATGGCGGACGAGAAAGAGGCGAAGGAAGTGGTTGTTGCGAAGACCGATGATAAGGATACGAAGAAGAGCAAGAAGAAGAGCGGTATTTTCTCTCGAATTTGGAATGCTGTGTTTAGGTCGCGAAGCGATGATTTTGAGAAGAGGTTGCAGTATATATCTAAAGAAGAGGCTACGCTTATTTCGCGAATGAAGAGGCGATCTCTGAGATGGAGGCGAACGGCGAGGAATTTAATCATCTTCTCCGTCGTCCTTGAGATTGT...

Protein

Download Protein FASTA

394 aa · TkA04G343830|TK1151|PROTEIN

MADEKEAKEVVVAKTDDKDTKKSKKKSGIFSRIWNAVFRSRSDDFEKRLQYISKEEATLISRMKRRSLRWRRTARNLIIFSVVLEIVAVGYAIMTTRTANMEWRMRSLRVLPMFLLPALSFALHYGLLSFTRFGDRRDQKALEKLRAERQAKIDELKERTNYYITQQLIQKYDPDPAAKAAAASVLASKLGADSGLKMFLGDESQPNPYSTGKNNEVEVHQTTGLRKRNQSNLKSQGSNASQQSQKEFGDGVSERLPHGD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA04G343830`
TK1151 ID	TkA04G343830
OH-1004 ID	LXL04_037733
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	86.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA04G343830

Location Chr04:86896555-86898643 (-)

Description Similar to At2g24330: Uncharacterized protein At2g24330

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g24330`	Uncharacterized protein At2g24330.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037733 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007029 endoplasmic reticulum organization Biological Process

GO:0071784 endoplasmic reticulum cisternal network assembly Biological Process

GO:0071786 endoplasmic reticulum tubular network organization Biological Process

GO:0071788 endoplasmic reticulum tubular network maintenance Biological Process

GO:1903373 positive regulation of endoplasmic reticulum tubular network organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0071782 endoplasmic reticulum tubular network Cellular Component

GO:0097225 sperm midpiece Cellular Component

KEGG gene cross-reference

ath:AT2G24330

hsa:80856

mmu:69605

pon:100173134

tru:100125769

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.443

Rank 1 · TkA04G343830 · TK1151

Golgi apparatus0.308

Rank 2 · TkA04G343830 · TK1151

Nucleus0.150

Rank 3 · TkA04G343830 · TK1151

Cytoplasm0.140

Rank 4 · TkA04G343830 · TK1151

Cell membrane0.094

Rank 5 · TkA04G343830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31016Lunapark_N44-172 aa

PF076945TM-5TMR_LYT60-128 aa

PF25923DUF7969216-234 aa

PF076945TM-5TMR_LYT269-287 aa

PF10058Zn_ribbon_10278-328 aa

PF10122Zn_ribbon_Com297-338 aa

PF25923DUF7969317-338 aa

PF24463DUF7577320-330 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA04G343830	`PF31016`	Lunapark_N	44	172	3.6e-06	27.8
TkA04G343830	`PF07694`	5TM-5TMR_LYT	60	128	0.036	14.4
TkA04G343830	`PF25923`	DUF7969	216	234	0.14	13.1
TkA04G343830	`PF07694`	5TM-5TMR_LYT	269	287	0.036	14.4
TkA04G343830	`PF10058`	Zn_ribbon_10	278	328	4.2e-19	68.8
TkA04G343830	`PF10122`	Zn_ribbon_Com	297	338	0.047	13.9
TkA04G343830	`PF25923`	DUF7969	317	338	0.14	13.1
TkA04G343830	`PF24463`	DUF7577	320	330	0.09	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZQ34`	Arabidopsis thaliana	sp\|Q9ZQ34\|Y2433_ARATH Uncharacterized protein At2g24330	61.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card